Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVasopressin V2 Receptor
LigandBDBM50087552
Substrate/Competitorn/a
Meas. Tech.ChEBML_226394
IC50 2.6±n/a nM
Citation Albright, JDDelos Santos, EGDusza, JPChan, PSCoupet, JRu, XMazandarani, H The synthesis and vasopressin (AVP) antagonist activity of a novel series of N-aroyl-2,4,5,6-tetrahydropyrazolo[3,4-d]thieno[3,2-b]azepines. Bioorg Med Chem Lett10:695-8 (2000) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Vasopressin V2 Receptor
Name:Vasopressin receptor
Synonyms:AVPR V2 | Antidiuretic hormone receptor | Renal-type arginine vasopressin receptor | VASOPRESSIN V2
Type:G-protein coupled receptor
Mol. Mass.:40761.85
Organism:Rattus norvegicus (Rat)
Description:n/a
Residue:371
Sequence:
MLLVSTVSAVPGLFSPPSSPSNSSQEELLDDRDPLLVRAELALLSTIFVAVALSNGLVLG
ALIRRGRRGRWAPMHVFISHLCLADLAVALFQVLPQLAWDATDRFHGPDALCRAVKYLQM
VGMYASSYMILAMTLDRHRAICRPMLAYRHGGGARWNRPVLVAWAFSLLLSLPQLFIFAQ
RDVGNGSGVFDCWARFAEPWGLRAYVTWIALMVFVAPALGIAACQVLIFREIHASLVPGP
SERAGRRRRGRRTGSPSEGAHVSAAMAKTVRMTLVIVIVYVLCWAPFFLVQLWAAWDPEA
PLERPPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCAQRHTTHSLGPQDESCAT
ASSSLMKDTPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50087552
NameBDBM50087552
Synonyms:Biphenyl-2-carboxylic acid [4-(5H,11H-benzo[e]pyrrolo[1,2-a][1,4]diazepine-10-carbonyl)-phenyl]-amide | CHEMBL159823
TypeSmall organic molecule
Emp. Form.C32H25N3O2
Mol. Mass.483.5598
SMILESO=C(Nc1ccc(cc1)C(=O)N1Cc2cccn2Cc2ccccc12)c1ccccc1-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a