Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGrik5
LigandBDBM26431
Substrate/Competitorn/a
Meas. Tech.ChEMBL_90601
Ki 750±n/a nM
Citation Pedregal, CCollado, IEscribano, AEzquerra, JDomínguez, CMateo, AIRubio, ABaker, SRGoldsworthy, JKamboj, RKBallyk, BAHoo, KBleakman, D 4-Alkyl- and 4-cinnamylglutamic acid analogues are potent GluR5 kainate receptor agonists. J Med Chem43:1958-68 (2000) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Grik5
Name:Ionotropic glutamate receptor kainate 2/5
Synonyms:Glutamate receptor ionotropic kainate 5 | Glutamate receptor, ionotropic kainate 5 | Glutamate-Kainate 5 | Ionotropic glutamate receptor kainate 2/5
Type:Enzyme Catalytic Domain
Mol. Mass.:109280.81
Organism:Homo sapiens (Human)
Description:Glutamate-Kainate 5 Grik5 HUMAN::Q16478
Residue:980
Sequence:
MPAELLLLLIVAFASPSCQVLSSLRMAAILDDQTVCGRGERLALALAREQINGIIEVPAK
ARVEVDIFELQRDSQYETTDTMCQILPKGVVSVLGPSSSPASASTVSHICGEKEIPHIKV
GPEETPRLQYLRFASVSLYPSNEDVSLAVSRILKSFNYPSASLICAKAECLLRLEELVRG
FLISKETLSVRMLDDSRDPTPLLKEIRDDKVSTIIIDANASISHLILRKASELGMTSAFY
KYILTTMDFPILHLDGIVEDSSNILGFSMFNTSHPFYPEFVRSLNMSWRENCEASTYLGP
ALSAALMFDAVHVVVSAVRELNRSQEIGVKPLACTSANIWPHGTSLMNYLRMVEYDGLTG
RVEFNSKGQRTNYTLRILEKSRQGHREIGVWYSNRTLAMNATTLDINLSQTLANKTLVVT
TILENPYVMRRPNFQALSGNERFEGFCVDMLRELAELLRFRYRLRLVEDGLYGAPEPNGS
WTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLD
PFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRARPHILENQYTLGNSLWFPV
GGFMQQGSEIMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPVESADDLAD
QTNIEYGTIHAGSTMTFFQNSRYQTYQRMWNYMQSKQPSVFVKSTEEGIARVLNSRYAFL
LESTMNEYHRRLNCNLTQIGGLLDTKGYGIGMPLGSPFRDEITLAILQLQENNRLEILKR
KWWEGGRCPKEEDHRAKGLGMENIGGIFIVLICGLIIAVFVAVMEFIWSTRRSAESEEVS
VCQEMLQELRHAVSCRKTSRSRRRRRPGGPSRALLSLRAVREMRLSNGKLYSAGAGGDAG
SAHGGPQRLLDDPGPPSGARPAAPTPCTHVRVCQECRRIQALRASGAGAPPRGLGVPAEA
TSPPRPRPGPAGPRELAEHE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26431
NameBDBM26431
Synonyms:(2R)-2-aminopentanedioic acid | CHEMBL76232 | D-Glu | D-Glutamate | D-[14C]Glu
Typeradiolabeled amino acid
Emp. Form.C5H9NO4
Mol. Mass.147.1293
SMILESN[C@H](CCC(O)=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a