Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAtrial natriuretic peptide receptor
LigandBDBM50091758
Substrate/Competitorn/a
Meas. Tech.ChEBML_34995
Ki 0.300000±n/a nM
Citation Veale, CAAlford, VCAharony, DBanville, DLBialecki, RABrown, FJDamewood, JRDantzman, CLEdwards, PDJacobs, RTMauger, RCMurphy, MMPalmer, WPine, KKRumsey, WLGarcia-Davenport, LEShaw, ASteelman, GBSurian, JMVacek, EP The discovery of non-basic atrial natriuretic peptide clearance receptor antagonists. Part 1. Bioorg Med Chem Lett10:1949-52 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Atrial natriuretic peptide receptor
Name:Atrial natriuretic peptide receptor
Synonyms:ANP-A | ANPRA | Atrial natriuretic peptide A-type receptor | Atrial natriuretic peptide receptor A | GC-A | Guanylate cyclase | NPR-A
Type:PROTEIN
Mol. Mass.:118919.35
Organism:Homo sapiens
Description:ChEMBL_700223
Residue:1061
Sequence:
MPGPRRPAGSRLRLLLLLLLPPLLLLLRGSHAGNLTVAVVLPLANTSYPWSWARVGPAVE
LALAQVKARPDLLPGWTVRTVLGSSENALGVCSDTAAPLAAVDLKWEHNPAVFLGPGCVY
AAAPVGRFTAHWRVPLLTAGAPALGFGVKDEYALTTRAGPSYAKLGDFVAALHRRLGWER
QALMLYAYRPGDEEHCFFLVEGLFMRVRDRLNITVDHLEFAEDDLSHYTRLLRTMPRKGR
VIYICSSPDAFRTLMLLALEAGLCGEDYVFFHLDIFGQSLQGGQGPAPRRPWERGDGQDV
SARQAFQAAKIITYKDPDNPEYLEFLKQLKHLAYEQFNFTMEDGLVNTIPASFHDGLLLY
IQAVTETLAHGGTVTDGENITQRMWNRSFQGVTGYLKIDSSGDRETDFSLWDMDPENGAF
RVVLNYNGTSQELVAVSGRKLNWPLGYPPPDIPKCGFDNEDPACNQDHLSTLEVLALVGS
LSLLGILIVSFFIYRKMQLEKELASELWRVRWEDVEPSSLERHLRSAGSRLTLSGRGSNY
GSLLTTEGQFQVFAKTAYYKGNLVAVKRVNRKRIELTRKVLFELKHMRDVQNEHLTRFVG
ACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAICSHGN
LKSSNCVVDGRFVLKITDYGLESFRDLDPEQGHTVYAKKLWTAPELLRMASPPVRGSQAG
DVYSFGIILQEIALRSGVFHVEGLDLSPKEIIERVTRGEQPPFRPSLALQSHLEELGLLM
QRCWAEDPQERPPFQQIRLTLRKFNRENSSNILDNLLSRMEQYANNLEELVEERTQAYLE
EKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTL
LNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGRLHACEVARMALALLDAVRSFR
IRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSET
KAVLEEFGGFELELRGDVEMKGKGKVRTYWLLGERGSSTRG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50091758
NameBDBM50091758
Synonyms:(S)-N-[(S)-4-Guanidino-1-((S)-2-methyl-butylcarbamoyl)-butyl]-3-{(2S,3S)-3-methyl-2-[(S)-2-(2-{4-[(naphthalene-2-carbonyl)-amino]-phenyl}-acetylamino)-propionylamino]-pentanoylamino}-succinamic acid | CHEMBL294263
TypeSmall organic molecule
Emp. Form.C43H59N9O8
Mol. Mass.829.9841
SMILESCC[C@H](C)CNC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)Cc1ccc(NC(=O)c2ccc3ccccc3c2)cc1)[C@@H](C)CC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a