Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTrypsin-1
LigandBDBM50093061
Substrate/Competitorn/a
Meas. Tech.ChEBML_212696
IC50 2500±n/a nM
Citation Semple, JELevy, OEMinami, NKOwens, TDSiev, DV Novel, potent and selective chimeric FXa inhibitors featuring hydrophobic P1-ketoamide moieties. Bioorg Med Chem Lett10:2305-9 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Trypsin-1
Name:Thrombin & trypsin
Synonyms:Alpha-trypsin chain 1 | Alpha-trypsin chain 2 | Beta-trypsin | Cationic trypsinogen | PRSS1 | Serine protease 1 | Trypsin | Trypsin I
Type:Enzyme
Mol. Mass.:26557.80
Organism:Homo sapiens (Human)
Description:P07477
Residue:247
Sequence:
MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK
NTIAANS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50093061
NameBDBM50093061
Synonyms:(R)-5-Guanidino-2-phenylmethanesulfonylamino-pentanoic acid [((S)-2-benzylcarbamoyl-1-cyclohexylmethyl-2-oxo-ethylcarbamoyl)-methyl]-methyl-amide | CHEMBL75017
TypeSmall organic molecule
Emp. Form.C33H47N7O6S
Mol. Mass.669.835
SMILESCN(CC(=O)N[C@@H](CC1CCCCC1)C(=O)C(=O)NCc1ccccc1)C(=O)[C@@H](CCCNC(N)=N)NS(=O)(=O)Cc1ccccc1
Structure
n/a