Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSomatostatin receptor type 2
LigandBDBM50096831
Substrate/Competitorn/a
Meas. Tech.ChEBML_200365
Ki 9±n/a nM
Citation Zhou, CGuo, LMorriello, GPasternak, APan, YRohrer, SPBirzin, ETHuskey, SEJacks, TSchleim, KDCheng, KSchaeffer, JMPatchett, AAYang, L Nipecotic and iso-nipecotic amides as potent and selective somatostatin subtype-2 receptor agonists. Bioorg Med Chem Lett11:415-7 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Somatostatin receptor type 2
Name:Somatostatin receptor type 2
Synonyms:SOMATOSTATIN SST2 | SRIF-1 | SS-2-R | SS2-R | SS2R | SSTR2 | Somatostatin receptor type 2 (SSTR2)
Type:Enzyme
Mol. Mass.:41344.94
Organism:Homo sapiens (Human)
Description:P30874
Residue:369
Sequence:
MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCG
NTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMT
VDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIY
AGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGI
RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVL
TYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTL
LNGDLQTSI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50096831
NameBDBM50096831
Synonyms:(S)-6-Amino-2-((S)-3-(1H-indol-3-yl)-2-{[1-(3-methoxy-phenylcarbamoyl)-piperidine-3-carbonyl]-amino}-butyrylamino)-hexanoic acid tert-butyl ester | CHEMBL134353
TypeSmall organic molecule
Emp. Form.C36H50N6O6
Mol. Mass.662.8188
SMILESCOc1cccc(NC(=O)N2CCCC(C2)C(=O)NC([C@@H](C)c2c[nH]c3ccccc23)C(=O)N[C@@H](CCCCN)C(=O)OC(C)(C)C)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a