Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-xylosidase
LigandBDBM50096896
Substrate/Competitorn/a
Meas. Tech.ChEBML_41519
Ki 1000000±n/a nM
Citation Guo, WHiratake, JOgawa, KYamamoto, MMa, SJSakata, K Beta-D-glycosylamidines: potent, selective, and easily accessible 1-glycosidase inhibitors. Bioorg Med Chem Lett11:467-70 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-xylosidase
Name:Beta-xylosidase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:87181.84
Organism:Aspergillus niger
Description:ChEMBL_41519
Residue:804
Sequence:
MAHSMSRPVAATAAALLALALPQALAQANTSYVDYNIEANPDLYPLCIETIPLSFPDCQN
GPLRSHLICDETATPYDRAASLISLFTLDELIANTGNTGLGVSRLGLPAYQVWSEALHGL
DRANFSDSGAYNWATSFPQPILTTAALNRTLIHQIASIISTQGRAFNNAGRYGLDVYAPN
INTFRHPVWGRGQETPGEDVSLAAVYAYEYITGIQGPDPESNLKLAATAKHYAGYDIENW
HNHSRLGNDMNITQQDLSEYYTPQFHVAARDAKVQSVMCAYNAVNGVPACADSYFLQTLL
RDTFGFVDHGYVSSDCDAAYNIYNPHGYASSQAAAAAEAILAGTDIDCGTTYQWHLNESI
AAGDLSRDDIEQGVIRLYTTLVQAGYFDSNTTKANNPYRDLSWSDVLETDAWNISYQAAT
QGIVLLKNSNNVLPLTEKAYPPSNTTVALIGPWANATTQLLGNYYGNAPYMISPRAAFEE
AGYKVNFAEGTGISSTSTSGFAAALSAAQSADVIIYAGGIDNTLEAEALDRESIAWPGNQ
LDLIQKLASAAGKKPLIVLQMGGGQVDSSSLKNNTNVSALLWGGYPGQSGGFALRDIITG
KKNPAGRLVTTQYPASYAEEFPATDMNLRPEGDNPGQTYKWYTGEAVYEFGHGLFYTTFA
ESSSNTTTKEVKLNIQDILSQTHEDLASITQLPVLNFTANIRNTGKLESDYTAMVFANTS
DAGPAPYPKKWLVGWDRLGEVKVGETRELRVPVEVGSFARVNEDGDWVVFPGTFELALNL
ERKVRVKVVLEGEEEVVLKWPGKE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50096896
NameBDBM50096896
Synonyms:2-phenyl-1-{[3,4,5-trihydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-2-yl]amino}ethaniminium;Bromide salt | CHEMBL343233
TypeSmall organic molecule
Emp. Form.C14H21N2O5
Mol. Mass.297.3264
SMILESN\C(Cc1ccccc1)=[NH+]/C1OC(CO)C(O)C(O)C1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a