Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTubulin polymerization-promoting protein
LigandBDBM50099947
Substrate/Competitorn/a
Meas. Tech.ChEMBL_925239
EC50 6250±n/a nM
Citation Young, DHTice, CMMichelotti, ELRoemmele, RCSlawecki, RARubio, FMRolling, JA Structure-activity relationships of phenylcyclohexene and biphenyl antitubulin compounds against plant and mammalian cells. Bioorg Med Chem Lett11:1393-6 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tubulin polymerization-promoting protein
Name:Tubulin polymerization-promoting protein
Synonyms:25 kDa brain-specific protein | TPPP
Type:PROTEIN
Mol. Mass.:23484.86
Organism:Bos taurus
Description:ChEMBL_106635
Residue:218
Sequence:
MADSRPKPANKTPPKSPGEPAKDKAAKRLSLEAEGAGEGAAAAGAELSALEEAFRKFAVH
GDARASGREMHGKNWSKLCRDCQVIDGRSVTVTDVDIVFSKIKGKSCRTITFEQFKEALE
ELAKKRFKDKSAEEAVREVHKLIEGKAPIISGVTKAISSPTVSRLTDTSKFTGSHKERFD
PSGRGKGRAGRVDLVDESGYVPGYKHAGTYDQKVQGGK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50099947
NameBDBM50099947
Synonyms:2,3,4,4'-Tetramethoxy-biphenyl | CHEMBL28250
TypeSmall organic molecule
Emp. Form.C16H18O4
Mol. Mass.274.3117
SMILESCOc1ccc(cc1)-c1ccc(OC)c(OC)c1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a