Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuropeptide Y receptor type 5 ( NPY Y5)
LigandBDBM50101570
Substrate/Competitorn/a
Meas. Tech.ChEMBL_143298
IC50 70±n/a nM
Citation Fotsch, CSonnenberg, JDChen, NHale, CKarbon, WNorman, MH Synthesis and structure-activity relationships of trisubstituted phenyl urea derivatives as neuropeptide Y5 receptor antagonists. J Med Chem44:2344-56 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Neuropeptide Y receptor type 5 ( NPY Y5)
Name:Neuropeptide Y receptor type 5
Synonyms:NPY-Y5 | NPY-Y5 receptor | NPY5-R | NPY5R | NPYY5 | Y5 receptor
Type:Enzyme
Mol. Mass.:50746.64
Organism:Homo sapiens (Human)
Description:Q15761
Residue:445
Sequence:
MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNL
LILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFL
QCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSL
VELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISC
GLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAP
ERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIK
KRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCL
NPILYGFLNNGIKADLVSLIHCLHM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50101570
NameBDBM50101570
Synonyms:1-(2-Hydroxy-1-methyl-2-phenyl-ethyl)-1-methyl-3-(4-phenoxy-phenyl)-thiourea | CHEMBL77010
TypeSmall organic molecule
Emp. Form.C23H24N2O2S
Mol. Mass.392.514
SMILESC[C@H]([C@@H](O)c1ccccc1)N(C)C(=S)Nc1ccc(Oc2ccccc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a