Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A3
LigandBDBM50097446
Substrate/Competitorn/a
Meas. Tech.ChEBML_29903
Ki 79±n/a nM
Citation van Tilburg, EWvan der Klein, PAde Groote, MBeukers, MWIJzerman, AP Substituted 4-phenyl-2-(phenylcarboxamido)-1,3-thiazole derivatives as antagonists for the adenosine A(1) receptor. Bioorg Med Chem Lett11:2017-9 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A3
Name:Adenosine receptor
Synonyms:A3 adenosine receptor (hA3) | Adenosine A3 receptor (A3AR)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:36197.32
Organism:Homo sapiens (Human)
Description:P0DMS8
Residue:318
Sequence:
MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
VVCHPSDSLDTSIEKNSE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50097446
NameBDBM50097446
Synonyms:4-Methoxy-N-(3-phenyl-isoquinolin-1-yl)-benzamide | CHEMBL62075
TypeSmall organic molecule
Emp. Form.C23H18N2O2
Mol. Mass.354.4012
SMILESCOc1ccc(cc1)C(=O)Nc1nc(cc2ccccc12)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a