Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine Kinase (AK)
LigandBDBM50104164
Substrate/Competitorn/a
Meas. Tech.ChEMBL_31126
IC50 4±n/a nM
Citation Lee, CHDaanen, JFJiang, MYu, HKohlhaas, KLAlexander, KJarvis, MFKowaluk, ELBhagwat, SS Synthesis and biological evaluation of clitocine analogues as adenosine kinase inhibitors. Bioorg Med Chem Lett11:2419-22 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Adenosine Kinase (AK)
Name:Adenosine Kinase (AK)
Synonyms:ADENOSINE | Adenosine 5-phosphotransferase
Type:Enzyme
Mol. Mass.:40130.14
Organism:Rattus norvegicus (rat)
Description:Rat brain cytosol as enzyme source.
Residue:361
Sequence:
MAAADEPKPKKLKVEAPEALSENVLFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDK
HKELFDELVKKFKVEYHAGGSTQNSMKVAQWMIQEPHRAATFFGCIGIDKFGEILKSKAA
DAHVDAHYYEQNEQPTGTCAACITGGNRSLVANLAAANCYKKEKHLDLENNWMLVEKARV
YYIAGFFLTVSPESVLKVARYAAENNRTFTLNLSAPFISQFFKEALMEVMPYVDILFGNE
TEAATFAREQGFETKDIKEIARKTQALPKVNSKRQRTVIFTQGRDDTIVATGNDVTAFPV
LDQNQEEIVDTNGAGDAFVGGFLSQLVSNKPLTECIRAGHYAASVIIRRTGCTFPEKPDF
H
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50104164
n/a
NameBDBM50104164
Synonyms:4-((2R,3R,4S,5R)-5-Aminomethyl-3,4-dihydroxy-tetrahydro-furan-2-ylamino)-pyrimidine-5-carboxylic acid methyl ester | CHEMBL407574
TypeSmall organic molecule
Emp. Form.C11H16N4O5
Mol. Mass.284.2685
SMILESCOC(=O)c1cncnc1N[C@@H]1O[C@H](CN)[C@@H](O)[C@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: