Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTelomerase reverse transcriptase
LigandBDBM50104474
Substrate/Competitorn/a
Meas. Tech.ChEBML_210074
IC50 45200±n/a nM
Citation Sasaki, SEhara, TAlam, MRFujino, YHarada, NKimura, JNakamura, HMaeda, M Solid-Phase synthesis of a library constructed of aromatic phosphate, long alkyl chains and tryptophane components, and identification of potent dipeptide telomerase inhibitors. Bioorg Med Chem Lett11:2581-4 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Telomerase reverse transcriptase
Name:Telomerase reverse transcriptase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:127099.03
Organism:Homo sapiens (Human)
Description:ChEMBL_1447029
Residue:1132
Sequence:
MPRAPRCRAVRSLLRSHYREVLPLATFVRRLGPQGWRLVQRGDPAAFRALVAQCLVCVPW
DARPPPAAPSFRQVSCLKELVARVLQRLCERGAKNVLAFGFALLDGARGGPPEAFTTSVR
SYLPNTVTDALRGSGAWGLLLRRVGDDVLVHLLARCALFVLVAPSCAYQVCGPPLYQLGA
ATQARPPPHASGPRRRLGCERAWNHSVREAGVPLGLPAPGARRRGGSASRSLPLPKRPRR
GAAPEPERTPVGQGSWAHPGRTRGPSDRGFCVVSPARPAEEATSLEGALSGTRHSHPSVG
RQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSLRPSLTGARRL
VETIFLGSRPWMPGTPRRLPRLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVT
PAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGS
RHNERRFLRNTKKFISLGKHAKLSLQELTWKMSVRDCAWLRRSPGVGCVPAAEHRLREEI
LAKFLHWLMSVYVVELLRSFFYVTETTFQKNRLFFYRKSVWSKLQSIGIRQHLKRVQLRE
LSEAEVRQHREARPALLTSRLRFIPKPDGLRPIVNMDYVVGARTFRREKRAERLTSRVKA
LFSVLNYERARRPGLLGASVLGLDDIHRAWRTFVLRVRAQDPPPELYFVKVDVTGAYDTI
PQDRLTEVIASIIKPQNTYCVRRYAVVQKAAHGHVRKAFKSHVSTLTDLQPYMRQFVAHL
QETSPLRDAVVIEQSSSLNEASSGLFDVFLRFMCHHAVRIRGKSYVQCQGIPQGSILSTL
LCSLCYGDMENKLFAGIRRDGLLLRLVDDFLLVTPHLTHAKTFLRTLVRGVPEYGCVVNL
RKTVVNFPVEDEALGGTAFVQMPAHGLFPWCGLLLDTRTLEVQSDYSSYARTSIRASLTF
NRGFKAGRNMRRKLFGVLRLKCHSLFLDLQVNSLQTVCTNIYKILLLQAYRFHACVLQLP
FHQQVWKNPTFFLRVISDTASLCYSILKAKNAGMSLGAKGAAGPLPSEAVQWLCHQAFLL
KLTRHRVTYVPLLGSLRTAQTQLSRKLPGTTLTALEAAANPALPSDFKTILD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50104474
NameBDBM50104474
Synonyms:CHEMBL262163 | Phosphoric acid 12-[(R)-2-amino-3-(1H-indol-3-yl)-propionylamino]-dodecyl ester 2-chloro-phenyl ester; compound with triethyl-amine
TypeSmall organic molecule
Emp. Form.C29H41ClN3O5P
Mol. Mass.578.08
SMILESN[C@H](Cc1c[nH]c2ccccc12)C(=O)NCCCCCCCCCCCCOP(O)(=O)Oc1ccccc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a