Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThrombin
LigandBDBM50107065
Substrate/Competitorn/a
Meas. Tech.ChEMBL_225578
Ki 900±n/a nM
Citation Lévesque, SSt-Denis, YBachand, BPréville, PLeblond, LWinocour, PDEdmunds, JJRubin, JRSiddiqui, MA Novel bicyclic lactam inhibitors of thrombin: potency and selectivity optimization through P1 residues. Bioorg Med Chem Lett11:3161-4 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Thrombin
Name:Thrombin
Synonyms:Activated blood-coagulation factor II | Activation peptide fragment 1 | Activation peptide fragment 2 | Beta-thrombin | Blood-coagulation factor IIa | Coagulation factor II | E thrombin | Factor IIa | Fibrinogenase | Gamma-thrombin | Prothrombin | Thrombase | Thrombin heavy chain | Thrombin light chain | Thrombin-C | Thrombofort | Tropostasin
Type:Protein
Mol. Mass.:70413.05
Organism:Rattus norvegicus
Description:P18292
Residue:617
Sequence:
MLHVRGLGLPGCLALAALASLVHSQHVFLAPQQALSLLQRVRRANSGFLEELRKGNLERE
CVEEQCSYEEAFEALESPQDTDVFWAKYTVCDSVRKPRETFMDCLEGRCAMDLGLNYHGN
VSVTHTGIECQLWRSRYPHRPDINSTTHPGADLKENFCRNPDSSTSGPWCYTTDPTVRRE
ECSIPVCGQEGRTTVKMTPRSRGSKENLSPPLGECLLERGRLYQGNLAVTTLGSPCLAWD
SLPTKTLSKYQNFDPEVKLVQNFCRNPDRDEEGAWCFVAQQPGFEYCSLNYCDEAVGEEN
HDGDESIAGRTTDAEFHTFFDERTFGLGEADCGLRPLFEKKSLTDKTEKELLDSYIDGRI
VEGWDAEKGIAPWQVMLFRKSPQELLCGASLISDRWVLTAAHCILYPPWDKNFTENDLLV
RIGKHSRTRYERNVEKISMLEKIYIHPRYNWRENLDRDIALLKLKKPVPFSDYIHPVCLP
DKQTVTSLLQAGYKGRVTGWGNLRETWTTNINEIQPSVLQVVNLPIVERPVCKASTRIRI
TDNMFCAGFKVNDTKRGDACEGDSGGPFVMKSPYNHRWYQMGIVSWGEGCDRNGKYGFYT
HVFRLKRWMQKVIDQHR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50107065
n/a
NameBDBM50107065
Synonyms:(S)-4-Oxo-2-(3-phenyl-propionyl)-octahydro-pyrrolo[1,2-a]pyrazine-6-carboxylic acid (4-guanidino-butyl)-amide | CHEMBL110542
TypeSmall organic molecule
Emp. Form.C22H32N6O3
Mol. Mass.428.5279
SMILESNC(=N)NCCCCNC(=O)C1CC[C@H]2CN(CC(=O)N12)C(=O)CCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: