Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeroxisome proliferator-activated receptor alpha (PPAR alpha)
LigandBDBM50109555
Substrate/Competitorn/a
Meas. Tech.ChEMBL_220887
EC50 12400±n/a nM
Citation Sauerberg, PPettersson, IJeppesen, LBury, PSMogensen, JPWassermann, KBrand, CLSturis, JWöldike, HFFleckner, JAndersen, ASMortensen, SBSvensson, LARasmussen, HBLehmann, SVPolivka, ZSindelar, KPanajotova, VYnddal, LWulff, EM Novel tricyclic-alpha-alkyloxyphenylpropionic acids: dual PPARalpha/gamma agonists with hypolipidemic and antidiabetic activity. J Med Chem45:789-804 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peroxisome proliferator-activated receptor alpha (PPAR alpha)
Name:Peroxisome proliferator-activated receptor
Synonyms:Nuclear receptor subfamily 1 group C member 1 | PPAR alpha/gamma | PPAR-alpha | Peroxisome Proliferator-Activated Receptor alpha | Peroxisome proliferator-activated receptor
Type:Enzyme
Mol. Mass.:52222.08
Organism:Homo sapiens (Human)
Description:Q07869
Residue:468
Sequence:
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSC
PGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACE
GCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSE
KAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFV
IHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANL
DLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFD
FAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDI
FLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50109555
NameBDBM50109555
Synonyms:3-{4-[3-(6H-Dibenzo[b,e]oxepin-11-ylidene)-propoxy]-phenyl}-2-ethoxy-propionic acid | CHEMBL354863
TypeSmall organic molecule
Emp. Form.C28H28O5
Mol. Mass.444.5189
SMILESCCOC(Cc1ccc(OCC\C=C2\c3ccccc3COc3ccccc23)cc1)C(O)=O
Structure
n/a