Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine N-methyltransferase
LigandBDBM8961
Substrate/Competitorn/a
Meas. Tech.ChEMBL_87238
IC50 110±n/a nM
Citation Apelt, JLigneau, XPertz, HHArrang, JMGanellin, CRSchwartz, JCSchunack, WStark, H Development of a new class of nonimidazole histamine H(3) receptor ligands with combined inhibitory histamine N-methyltransferase activity. J Med Chem45:1128-41 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histamine N-methyltransferase
Name:Histamine N-methyltransferase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:33931.03
Organism:Rattus norvegicus
Description:ChEMBL_87236
Residue:295
Sequence:
MASFMRSLFSDHSRYVESFRRFLNNSTEHQCMQEFMDKKLPGIIARIGETKAEIKILSIG
GGAGEIDLQILSKVQAQYPGICINNEVVEPNAEQIVKYKELVAKTSNMENIKFAWHKETS
SEYQKRVVEEDEEPPKWDFIHMIQMLYYVKDIPATLKFFHGLLAANAKILIILVSGTSGW
EKLWKKYGFRLPRDDLCQYVTSSDLAQILDDLGIKYECYDLLSTMDITDCFIDGNENGDL
LWDFLTETCNFIKTAPLDLKEEIMKDLQEPEFSVKKEGKVLFNNNLSFIVVEANV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM8961
NameBDBM8961
Synonyms:1,2,3,4-tetrahydro-9-acridinamine | 1,2,3,4-tetrahydroacridin-9-amine | 9-THA | 9-amino-1,2,3,4-tetrahydroacridine (THA) | CHEMBL1337960 | CHEMBL95 | Cognex | Tacrine | Tracine | US8999994, Tacrine | cid_1935 | tacrine.HCl
TypeSmall organic molecule
Emp. Form.C13H14N2
Mol. Mass.198.2637
SMILESNc1c2CCCCc2nc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a