Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M2
LigandBDBM50110529
Substrate/Competitorn/a
Meas. Tech.ChEBML_139772
Ki 0.200000±n/a nM
Citation Kozlowski, JAZhou, GTagat, JRLin, SIMcCombie, SWRuperto, VBDuffy, RAMcQuade, RACrosby, GTaylor, LABillard, WBinch, HLachowicz, JE Substituted 2-(R)-methyl piperazines as muscarinic M(2) selective ligands. Bioorg Med Chem Lett12:791-4 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M2
Name:Muscarinic acetylcholine receptor M2 and M5
Synonyms:CHRM2 | Cholinergic, muscarinic M2 | RecName: Full=Muscarinic acetylcholine receptor M2
Type:GPCR
Mol. Mass.:51730.61
Organism:Homo sapiens (Human)
Description:P08172
Residue:466
Sequence:
MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKDKKEPVANQDPVSPSLVQGRI
VKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50110529
NameBDBM50110529
Synonyms:1-{1-[4-(Benzo[1,3]dioxole-5-sulfonyl)-phenyl]-ethyl}-4-[1-(butane-1-sulfonyl)-piperidin-4-yl]-2-methyl-piperazine | CHEMBL435849
TypeSmall organic molecule
Emp. Form.C29H41N3O6S2
Mol. Mass.591.782
SMILESCCCCS(=O)(=O)N1CCC(CC1)N1CCN([C@@H](C)c2ccc(cc2)S(=O)(=O)c2ccc3OCOc3c2)[C@H](C)C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a