Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine protease 1
LigandBDBM50097771
Substrate/Competitorn/a
Meas. Tech.ChEMBL_225790
Ki 980±n/a nM
Citation Liebeschuetz, JWJones, SDMorgan, PJMurray, CWRimmer, ADRoscoe, JMWaszkowycz, BWelsh, PMWylie, WAYoung, SCMartin, HMahler, JBrady, LWilkinson, K PRO_SELECT: combining structure-based drug design and array-based chemistry for rapid lead discovery. 2. The development of a series of highly potent and selective factor Xa inhibitors. J Med Chem45:1221-32 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine protease 1
Name:Serine protease 1
Synonyms:Beta-Trypsin | Cationic trypsin | Trypsin | Trypsin I
Type:Enzyme
Mol. Mass.:25790.52
Organism:Bos taurus (bovine)
Description:P00760
Residue:246
Sequence:
MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLN
SRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQIT
SNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIK
QTIASN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50097771
NameBDBM50097771
Synonyms:3-[(Z)-AMINO(IMINO)METHYL]-N-[2-(4-BENZOYL-1-PIPERIDINYL)-2-OXO-1-PHENYLETHYL]BENZAMIDE | CHEMBL283765 | N-[(R)-2-(4-Benzoyl-piperidin-1-yl)-2-oxo-1-phenyl-ethyl]-3-carbamimidoyl-benzamide | N-[2-(4-Benzoyl-piperidin-1-yl)-2-oxo-1-phenyl-ethyl]-3-carbamimidoyl-benzamide
TypeSmall organic molecule
Emp. Form.C28H28N4O3
Mol. Mass.468.5469
SMILESNC(=N)c1cccc(c1)C(=O)N[C@@H](C(=O)N1CCC(CC1)C(=O)c1ccccc1)c1ccccc1
Structure
n/a