Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M2
LigandBDBM50111324
Substrate/Competitorn/a
Meas. Tech.ChEBML_139766
Ki 11±n/a nM
Citation Wang, YChackalamannil, SHu, ZMcKittrick, BAGreenlee, WRuperto, VDuffy, RALachowicz, JE Sulfide analogues as potent and selective M(2) muscarinic receptor antagonists. Bioorg Med Chem Lett12:1087-91 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M2
Name:Muscarinic acetylcholine receptor M2 and M5
Synonyms:CHRM2 | Cholinergic, muscarinic M2 | RecName: Full=Muscarinic acetylcholine receptor M2
Type:GPCR
Mol. Mass.:51730.61
Organism:Homo sapiens (Human)
Description:P08172
Residue:466
Sequence:
MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKDKKEPVANQDPVSPSLVQGRI
VKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50111324
NameBDBM50111324
Synonyms:CHEMBL12542 | [4-(4-Isopropylsulfanyl-benzyl)-[1,4']bipiperidinyl-1'-yl]-isoquinolin-1-yl-methanone
TypeSmall organic molecule
Emp. Form.C30H37N3OS
Mol. Mass.487.699
SMILESCC(C)Sc1ccc(CC2CCN(CC2)C2CCN(CC2)C(=O)c2nccc3ccccc23)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a