Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscle-type nicotinic acetylcholine receptor
LigandBDBM50111637
Substrate/Competitorn/a
Meas. Tech.ChEMBL_142596
IC50 13300±n/a nM
Citation Strømgaard, KMellor, IRAndersen, KNeagoe, IPluteanu, FUsherwood, PNKrogsgaard-Larsen, PJaroszewski, JW Solid-phase synthesis and pharmacological evaluation of analogues of PhTX-12-A potent and selective nicotinic acetylcholine receptor antagonist. Bioorg Med Chem Lett12:1159-62 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Muscle-type nicotinic acetylcholine receptor
Name:Muscle-type nicotinic acetylcholine receptor
Synonyms:Acetylcholine receptor protein delta chain
Type:PROTEIN
Mol. Mass.:58894.39
Organism:Homo sapiens
Description:ChEMBL_142595
Residue:517
Sequence:
MEGPVLTLGLLAALAVCGSWGLNEEERLIRHLFQEKGYNKELRPVAHKEESVDVALALTL
SNLISLKEVEETLTTNVWIEHGWTDNRLKWNAEEFGNISVLRLPPDMVWLPEIVLENNND
GSFQISYSCNVLVYHYGFVYWLPPAIFRSSCPISVTYFPFDWQNCSLKFSSLKYTAKEIT
LSLKQDAKENRTYPVEWIIIDPEGFTENGEWEIVHRPARVNVDPRAPLDSPSRQDITFYL
IIRRKPLFYIINILVPCVLISFMVNLVFYLPADSGEKTSVAISVLLAQSVFLLLISKRLP
ATSMAIPLIGKFLLFGMVLVTMVVVICVIVLNIHFRTPSTHVLSEGVKKLFLETLPELLH
MSRPAEDGPSPGALVRRSSSLGYISKAEEYFLLKSRSDLMFEKQSERHGLARRLTTARRP
PASSEQAQQELFNELKPAVDGANFIVNHMRDQNNYNEEKDSWNRVARTVDRLCLFVVTPV
MVVGTAWIFLQGVYNQPPPQPFPGDPYSYNVQDKRFI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50111637
NameBDBM50111637
Synonyms:CHEMBL279418 | N-[(S)-1-(9-Amino-nonylcarbamoyl)-2-(4-hydroxy-phenyl)-ethyl]-butyramide
TypeSmall organic molecule
Emp. Form.C22H37N3O3
Mol. Mass.391.5475
SMILESCCCC(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)NCCCCCCCCCN
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a