Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-C chemokine receptor type 5
LigandBDBM50104941
Substrate/Competitorn/a
Meas. Tech.ChEMBL_49996
Ki 19±n/a nM
Citation Palani, AShapiro, SJosien, HBara, TClader, JWGreenlee, WJCox, KStrizki, JMBaroudy, BM Synthesis, SAR, and biological evaluation of oximino-piperidino-piperidine amides. 1. Orally bioavailable CCR5 receptor antagonists with potent anti-HIV activity. J Med Chem45:3143-60 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C-C chemokine receptor type 5
Name:C-C chemokine receptor type 5
Synonyms:C-C CKR-5 | CC-CKR-5 | CCR-5 | CD_antigen=CD195 | MIP-1 alpha receptor
Type:PROTEIN
Mol. Mass.:40803.93
Organism:Mus musculus
Description:ChEMBL_49996
Residue:354
Sequence:
MDFQGSVPTYSYDIDYGMSAPCQKINVKQIAAQLLPPLYSLVFIFGFVGNMMVFLILISC
KKLKSVTDIYLLNLAISDLLFLLTLPFWAHYAANEWVFGNIMCKVFTGLYHIGYFGGIFF
IILLTIDRYLAIVHAVFALKVRTVNFGVITSVVTWAVAVFASLPEIIFTRSQKEGFHYTC
SPHFPHTQYHFWKSFQTLKMVILSLILPLLVMVICYSGILHTLFRCRNEKKRHRAVRLIF
AIMIVYFLFWTPYNIVLLLTTFQEFFGLNNCSSSNRLDQAMQATETLGMTHCCLNPVIYA
FVGEKFRSYLSVFFRKHMVKRFCKRCSIFQQDNPDRASSVYTRSTGEHEVSTGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50104941
NameBDBM50104941
Synonyms:CHEMBL106098 | CHEMBL138198 | {4-[(4-Bromo-phenyl)-methoxyimino-methyl]-4'-methyl-[1,4']bipiperidinyl-1'-yl}-(2,4-dimethyl-1-oxy-pyridin-3-yl)-methanone
TypeSmall organic molecule
Emp. Form.C27H35BrN4O3
Mol. Mass.543.496
SMILESCO[N-][C+](C1CCN(CC1)C1(C)CCN(CC1)C(=O)c1c(C)cc[n+]([O-])c1C)c1ccc(Br)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a