Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-galactosidase/Glucosylceramidase
LigandBDBM50403936
Substrate/Competitorn/a
Meas. Tech.ChEMBL_37293
Ki 35000±n/a nM
Citation Moreno-Vargas, AJDemange, RFuentes, JRobina, IVogel, P Synthesis of [(2S,3S,4R)-3,4-dihydroxypyrrolidin-2-yl]-5-methylfuran-4-carboxylic acid derivatives: new leads as selective beta-galactosidase inhibitors. Bioorg Med Chem Lett12:2335-9 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Beta-galactosidase/Glucosylceramidase
Name:Beta-galactosidase/Glucosylceramidase
Synonyms:n/a
Type:Protein
Mol. Mass.:73420.88
Organism:Bos taurus (Bovine)
Description:n/a
Residue:653
Sequence:
MPGVVRLLALLLVPLLLGSARGLHNATQRTFQIDYRRNRFLKDGQPFRYISGSIHYFRVP
RFYWKDRLLKMKMAGLNAIQTYVAWNFHELQPGRYNFSGDHDVEHFIQLAHELGLLVILR
PGPYICAEWDMGGLPAWLLEKKSIVLRSSDPDYLAAVDKWLGVLLPKMRPLLYKNGGPII
TVQVENEYGSYLSCDYDYLRFLQKRFHDHLGEDVLLFTTDGVNERLLQCGALQGLYATVD
FSPGTNLTAAFMLQRKFEPTGPLVNSEFYTGWLDHWGQRHSTVSSKAVAFTLHDMLALGA
NVNMYMFIGGTNFAYWNGANIPYQPQPTSYDYDAPLSEAGDLTEKYFALRDIIQKFAKVP
EGPIPPSTPKFAYGKVALNKLKTVEDALNILCPSGPIKSVYPLTFIDVKQYFGFVLYRTM
LPEDCSDPTPLSSPLSGVHDRAYVSVNGVAQGILERESVITLNITGKAGATLDLLVENMG
RVNYGSSINDFKGLVSNLTLGSKILTNWEIFPLDMEDAVRSHLGTWGGRDRGYHNKARAH
SPPTYALPTFYVGNFTIPSGIADLPQDTFIQFPGWTKGQVWINGFNLGRYWPVRGPQMTL
FVPQHILVTSTPNTIVVLELEHAPCQDGGPELCTVEFVDKPVFRTVQTHRHAN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50403936
NameBDBM50403936
Synonyms:CHEMBL2114148
TypeSmall organic molecule
Emp. Form.C12H17NO5
Mol. Mass.255.2671
SMILESCCOC(=O)c1cc(oc1C)[C@H]1NC[C@@H](O)[C@H]1O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a