Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine Kinase (AK)
LigandBDBM50117169
Substrate/Competitorn/a
Meas. Tech.ChEMBL_31124
IC50 2±n/a nM
Citation Gomtsyan, ADidomenico, SLee, CHMatulenko, MAKim, KKowaluk, EAWismer, CTMikusa, JYu, HKohlhaas, KJarvis, MFBhagwat, SS Design, synthesis, and structure-activity relationship of 6-alkynylpyrimidines as potent adenosine kinase inhibitors. J Med Chem45:3639-48 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Adenosine Kinase (AK)
Name:Adenosine Kinase (AK)
Synonyms:ADENOSINE | Adenosine 5-phosphotransferase
Type:Enzyme
Mol. Mass.:40130.14
Organism:Rattus norvegicus (rat)
Description:Rat brain cytosol as enzyme source.
Residue:361
Sequence:
MAAADEPKPKKLKVEAPEALSENVLFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDK
HKELFDELVKKFKVEYHAGGSTQNSMKVAQWMIQEPHRAATFFGCIGIDKFGEILKSKAA
DAHVDAHYYEQNEQPTGTCAACITGGNRSLVANLAAANCYKKEKHLDLENNWMLVEKARV
YYIAGFFLTVSPESVLKVARYAAENNRTFTLNLSAPFISQFFKEALMEVMPYVDILFGNE
TEAATFAREQGFETKDIKEIARKTQALPKVNSKRQRTVIFTQGRDDTIVATGNDVTAFPV
LDQNQEEIVDTNGAGDAFVGGFLSQLVSNKPLTECIRAGHYAASVIIRRTGCTFPEKPDF
H
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50117169
n/a
NameBDBM50117169
Synonyms:5-[3-(4-Bromo-phenyl)-propyl]-6-(6-morpholin-4-yl-pyridin-3-ylethynyl)-pyrimidin-4-ylamine | CHEMBL122652
TypeSmall organic molecule
Emp. Form.C24H24BrN5O
Mol. Mass.478.384
SMILESNc1ncnc(C#Cc2ccc(nc2)N2CCOCC2)c1CCCc1ccc(Br)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: