Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPapain
LigandBDBM50118412
Substrate/Competitorn/a
Meas. Tech.ChEMBL_222141
Ki 24±n/a nM
Citation Wieczerzak, EDrabik, PŁankiewicz, LOldziej, SGrzonka, ZAbrahamson, MGrubb, ABrömme, D Azapeptides structurally based upon inhibitory sites of cystatins as potent and selective inhibitors of cysteine proteases. J Med Chem45:4202-11 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Papain
Name:Papain
Synonyms:Allergen=Car p 1 | PPI | Papaya proteinase I
Type:Enzyme
Mol. Mass.:38923.01
Organism:Carica papaya
Description:Papain was purchased from Sigma, Germany.
Residue:345
Sequence:
MAMIPSISKLLFVAICLFVYMGLSFGDFSIVGYSQNDLTSTERLIQLFESWMLKHNKIYK
NIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEFKEKYTGSIAGNYTTTE
LSYEEVLNDGDVNIPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNE
YSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKT
DGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYG
PNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50118412
n/a
NameBDBM50118412
Synonyms:Boc-Agly-Val-Agly-OEt | CHEMBL135413
TypeSmall organic molecule
Emp. Form.C19H36N4O6
Mol. Mass.416.5123
SMILESCCOC(=O)NNC(=O)C(NC(=O)C(CC(C)C)NC(=O)OC(C)(C)C)C(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: