Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin L
LigandBDBM50121031
Substrate/Competitorn/a
Meas. Tech.ChEBML_48517
IC50 600±n/a nM
Citation Zhou, NEGuo, DKaleta, JPurisima, EMenard, RMicetich, RGSingh, R Design and synthesis of 6-substituted amino-4-oxa-1-azabicyclo[3,2,0]heptan-7-one derivatives as cysteine proteases inhibitors. Bioorg Med Chem Lett12:3413-5 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cathepsin L
Name:Cathepsin L
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:37662.10
Organism:Rattus norvegicus
Description:ChEMBL_48517
Residue:334
Sequence:
MTPLLLLAVLCLGTALATPKFDQTFNAQWHQWKSTHRRLYGTNEEEWRRAVWEKNMRMIQ
LHNGEYSNGKHGFTMEMNAFGDMTNEEFRQIVNGYRHQKHKKGRLFQEPLMLQIPKTVDW
REKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHDQGNQGCNG
GLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEYAVANDTGFVDIPQQEKALMKAVA
TVGPISVAMDASHPSLQFYSSGIYYEPNCSSKDLDHGVLVVGYGYEGTDSNKDKYWLVKN
SWGKEWGMDGYIKIAKDRNNHCGLATAASYPIVN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50121031
NameBDBM50121031
Synonyms:CHEMBL419772 | [(S)-2-Methyl-1-((5R,6S)-7-oxo-4-oxa-1-aza-bicyclo[3.2.0]hept-6-ylcarbamoyl)-propyl]-carbamic acid benzyl ester
TypeSmall organic molecule
Emp. Form.C18H23N3O5
Mol. Mass.361.3923
SMILESCC(C)[C@H](NC(=O)OCc1ccccc1)C(=O)N[C@H]1[C@H]2OCCN2C1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a