Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin S
LigandBDBM50121577
Substrate/Competitorn/a
Meas. Tech.ChEMBL_48672
IC50 1400±n/a nM
Citation Ward, YDThomson, DSFrye, LLCywin, CLMorwick, TEmmanuel, MJZindell, RMcNeil, DBekkali, YGirardot, MHrapchak, MDeTuri, MCrane, KWhite, DPav, SWang, YHao, MHGrygon, CALabadia, MEFreeman, DMDavidson, WHopkins, JLBrown, MLSpero, DMGiradot, M Design and synthesis of dipeptide nitriles as reversible and potent Cathepsin S inhibitors. J Med Chem45:5471-82 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cathepsin S
Name:Cathepsin S
Synonyms:CTSS | Cathepsin S (Cat S) | cathepsin S preproprotein
Type:Protein
Mol. Mass.:37507.38
Organism:Homo sapiens (Human)
Description:P25774
Residue:331
Sequence:
MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVM
LHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVD
WREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGC
NGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKE
AVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSW
GHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50121577
NameBDBM50121577
Synonyms:CHEMBL149687 | Morpholine-4-carboxylic acid [1-(1-cyano-2-methyl-propylcarbamoyl)-3-methyl-butyl]-amide
TypeSmall organic molecule
Emp. Form.C16H28N4O3
Mol. Mass.324.4185
SMILESCC(C)C[C@H](NC(=O)N1CCOCC1)C(=O)N[C@H](C#N)C(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a