Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetStromelysin-1
LigandBDBM26193
Substrate/Competitorn/a
Meas. Tech.ChEMBL_205633
Kd>25000000±n/a nM
Citation Hajduk, PJShuker, SBNettesheim, DGCraig, RAugeri, DJBetebenner, DAlbert, DHGuo, YMeadows, RPXu, LMichaelides, MDavidsen, SKFesik, SW NMR-based modification of matrix metalloproteinase inhibitors with improved bioavailability. J Med Chem45:5628-39 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Stromelysin-1
Name:Matrix metalloproteinase (2 and 3)
Synonyms:MMP-3 | Matrix metalloproteinase 3 | Matrix metalloproteinase-3 | Matrix metalloproteinase-3 (MMP-3) | Matrix metalloproteinase-3 (MMP3) | SL-1 | Stromelysin 1 | Transin-1
Type:Enzyme
Mol. Mass.:53973.13
Organism:Homo sapiens (Human)
Description:
Residue:477
Sequence:
MKSLPILLLLCVAVCSAYPLDGAARGEDTSMNLVQKYLENYYDLKKDVKQFVRRKDSGPV
VKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVN
YTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNV
LAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLY
HSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVS
TLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQF
WAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEP
GFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26193
NameBDBM26193
Synonyms:2-Hydroxybenzoate, I | 2-hydroxybenzoic acid | CHEMBL424 | phenol derivative, 7 | salicylic acid
TypeSmall organic molecule
Emp. Form.C7H6O3
Mol. Mass.138.1207
SMILESOC(=O)c1ccccc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a