Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTelomerase reverse transcriptase
LigandBDBM50124727
Substrate/Competitorn/a
Meas. Tech.ChEBML_210222
IC50 64000±n/a nM
Citation Jew, SSPark, BSLim, DYKim, MGChung, IKKim, JHHong, CIKim, JKPark, HJLee, JHPark, HG Synthesis of 6-formyl-pyridine-2-carboxylate derivatives and their telomerase inhibitory activities. Bioorg Med Chem Lett13:609-12 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Telomerase reverse transcriptase
Name:Telomerase reverse transcriptase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:127099.03
Organism:Homo sapiens (Human)
Description:ChEMBL_1447029
Residue:1132
Sequence:
MPRAPRCRAVRSLLRSHYREVLPLATFVRRLGPQGWRLVQRGDPAAFRALVAQCLVCVPW
DARPPPAAPSFRQVSCLKELVARVLQRLCERGAKNVLAFGFALLDGARGGPPEAFTTSVR
SYLPNTVTDALRGSGAWGLLLRRVGDDVLVHLLARCALFVLVAPSCAYQVCGPPLYQLGA
ATQARPPPHASGPRRRLGCERAWNHSVREAGVPLGLPAPGARRRGGSASRSLPLPKRPRR
GAAPEPERTPVGQGSWAHPGRTRGPSDRGFCVVSPARPAEEATSLEGALSGTRHSHPSVG
RQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSLRPSLTGARRL
VETIFLGSRPWMPGTPRRLPRLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVT
PAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGS
RHNERRFLRNTKKFISLGKHAKLSLQELTWKMSVRDCAWLRRSPGVGCVPAAEHRLREEI
LAKFLHWLMSVYVVELLRSFFYVTETTFQKNRLFFYRKSVWSKLQSIGIRQHLKRVQLRE
LSEAEVRQHREARPALLTSRLRFIPKPDGLRPIVNMDYVVGARTFRREKRAERLTSRVKA
LFSVLNYERARRPGLLGASVLGLDDIHRAWRTFVLRVRAQDPPPELYFVKVDVTGAYDTI
PQDRLTEVIASIIKPQNTYCVRRYAVVQKAAHGHVRKAFKSHVSTLTDLQPYMRQFVAHL
QETSPLRDAVVIEQSSSLNEASSGLFDVFLRFMCHHAVRIRGKSYVQCQGIPQGSILSTL
LCSLCYGDMENKLFAGIRRDGLLLRLVDDFLLVTPHLTHAKTFLRTLVRGVPEYGCVVNL
RKTVVNFPVEDEALGGTAFVQMPAHGLFPWCGLLLDTRTLEVQSDYSSYARTSIRASLTF
NRGFKAGRNMRRKLFGVLRLKCHSLFLDLQVNSLQTVCTNIYKILLLQAYRFHACVLQLP
FHQQVWKNPTFFLRVISDTASLCYSILKAKNAGMSLGAKGAAGPLPSEAVQWLCHQAFLL
KLTRHRVTYVPLLGSLRTAQTQLSRKLPGTTLTALEAAANPALPSDFKTILD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50124727
NameBDBM50124727
Synonyms:6-Formyl-pyridine-2-carbothioic acid S-(4-fluoro-phenyl) ester | CHEMBL347642
TypeSmall organic molecule
Emp. Form.C13H8FNO2S
Mol. Mass.261.272
SMILESFc1ccc(SC(=O)c2cccc(C=O)n2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a