Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphodiesterase 11A (PDE11A)
LigandBDBM50126457
Substrate/Competitorn/a
Meas. Tech.ChEBML_156293
IC50 22±n/a nM
Citation Maw, GNAllerton, CMGbekor, EMillion, WA Design, synthesis and biological activity of beta-carboline-based type-5 phosphodiesterase inhibitors. Bioorg Med Chem Lett13:1425-8 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Phosphodiesterase 11A (PDE11A)
Name:Phosphodiesterase 11A
Synonyms:Dual 3'''''''''''''''',5''''''''''''''''-cyclic-AMP and -GMP phosphodiesterase 11A | Phosphodiesterase 11 | Phosphodiesterase 11A | Phosphodiesterase 11A (PDE11A4) | Phosphodiesterase 11A4 | cAMP and cGMP phosphodiesterase 11A
Type:Enzyme
Mol. Mass.:104751.53
Organism:Homo sapiens (Human)
Description:Q9HCR9
Residue:933
Sequence:
MAASRLDFGEVETFLDRHPELFEDYLMRKGKQEMVEKWLQRHSQGQGALGPRPSLAGTSS
LAHSTCRGGSSVGGGTGPNGSAHSQPLPGGGDCGGVPLSPSWAGGSRGDGNLQRRASQKE
LRKSFARSKAIHVNRTYDEQVTSRAQEPLSSVRRRALLRKASSLPPTTAHILSALLESRV
NLPRYPPTAIDYKCHLKKHNERQFFLELVKDISNDLDLTSLSYKILIFVCLMVDADRCSL
FLVEGAAAGKKTLVSKFFDVHAGTPLLPCSSTENSNEVQVPWGKGIIGYVGEHGETVNIP
DAYQDRRFNDEIDKLTGYKTKSLLCMPIRSSDGEIIGVAQAINKIPEGAPFTEDDEKVMQ
MYLPFCGIAISNAQLFAASRKEYERSRALLEVVNDLFEEQTDLEKIVKKIMHRAQTLLKC
ERCSVLLLEDIESPVVKFTKSFELMSPKCSADAENSFKESMEKSSYSDWLINNSIAELVA
STGLPVNISDAYQDPRFDAEADQISGFHIRSVLCVPIWNSNHQIIGVAQVLNRLDGKPFD
DADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDVLSYHATCSKAEVDKFKAANI
PLVSELAIDDIHFDDFSLDVDAMITAALRMFMELGMVQKFKIDYETLCRWLLTVRKNYRM
VLYHNWRHAFNVCQLMFAMLTTAGFQDILTEVEILAVIVGCLCHDLDHRGTNNAFQAKSG
SALAQLYGTSATLEHHHFNHAVMILQSEGHNIFANLSSKEYSDLMQLLKQSILATDLTLY
FERRTEFFELVSKGEYDWNIKNHRDIFRSMLMTACDLGAVTKPWEISRQVAELVTSEFFE
QGDRERLELKLTPSAIFDRNRKDELPRLQLEWIDSICMPLYQALVKVNVKLKPMLDSVAT
NRSKWEELHQKRLLASTASSSPASVMVAKEDRN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50126457
NameBDBM50126457
Synonyms:(6R,12aR)-6-Benzo[1,3]dioxol-5-yl-2-[(R)-1-(3-methoxy-propyl)-pyrrolidin-3-yl]-2,3,6,7,12,12a-hexahydro-pyrazino[1',2':1,6]pyrido[3,4-b]indole-1,4-dione | CHEMBL34802
TypeSmall organic molecule
Emp. Form.C29H32N4O5
Mol. Mass.516.5882
SMILESCOCCCN1CC[C@H](C1)N1CC(=O)N2[C@H](Cc3c([nH]c4ccccc34)[C@H]2c2ccc3OCOc3c2)C1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a