Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBRS3
LigandBDBM50127525
Substrate/Competitorn/a
Meas. Tech.ChEMBL_39239
EC50 46±n/a nM
Citation Weber, DBerger, CEickelmann, PAntel, JKessler, H Design of selective peptidomimetic agonists for the human orphan receptor BRS-3. J Med Chem46:1918-30 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
BRS3
Name:BRS3
Synonyms:BRS-3 | Bombesin 3 | Bombesin like receptor 3
Type:Enzyme Catalytic Domain
Mol. Mass.:44424.45
Organism:Homo sapiens (Human)
Description:Bombesin 3 BRS3 HUMAN::P32247
Residue:399
Sequence:
MAQRQPHSPNQTLISITNDTESSSSVVSNDNTNKGWSGDNSPGIEALCAIYITYAVIISV
GILGNAILIKVFFKTKSMQTVPNIFITSLAFGDLLLLLTCVPVDATHYLAEGWLFGRIGC
KVLSFIRLTSVGVSVFTLTILSADRYKAVVKPLERQPSNAILKTCVKAGCVWIVSMIFAL
PEAIFSNVYTFRDPNKNMTFESCTSYPVSKKLLQEIHSLLCFLVFYIIPLSIISVYYSLI
ARTLYKSTLNIPTEEQSHARKQIESRKRIARTVLVLVALFALCWLPNHLLYLYHSFTSQT
YVDPSAMHFIFTIFSRVLAFSNSCVNPFALYWLSKSFQKHFKAQLFCCKAERPEPPVADT
SLTTLAVMGTVPGTGSIQMSEISVTSFTGCSVKQAEDRF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50127525
NameBDBM50127525
Synonyms:2-Benzylamino-N-[2-(1H-indol-3-yl)-1-phenethylcarbamoyl-ethyl]-propionamide | CHEMBL56195
TypeSmall organic molecule
Emp. Form.C29H32N4O2
Mol. Mass.468.59
SMILESCC(NCc1ccccc1)C(=O)NC(Cc1c[nH]c2ccccc12)C(=O)NCCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a