Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGRIK1
LigandBDBM50002370
Substrate/Competitorn/a
Meas. Tech.ChEMBL_90447
Ki 740±n/a nM
Citation Bjerrum, EJKristensen, ASPickering, DSGreenwood, JRNielsen, BLiljefors, TSchousboe, ABräuner-Osborne, HMadsen, U Design, synthesis, and pharmacology of a highly subtype-selective GluR1/2 agonist, (RS)-2-amino-3-(4-chloro-3-hydroxy-5-isoxazolyl)propionic acid (Cl-HIBO). J Med Chem46:2246-9 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
GRIK1
Name:Glutamate receptor ionotropic kainate
Synonyms:Glutamate kainate | Glutamate receptor ionotropic kainate | Glutamate receptor ionotropic kainate 1 | Glutamate receptor, ionotropic kainate 1 | Glutamate-Kainate | Glutamate-Kainate, GluR5 | Grik1 protein
Type:Enzyme Catalytic Domain
Mol. Mass.:103984.96
Organism:Homo sapiens (Human)
Description:P39086
Residue:918
Sequence:
MEHGTLLAQPGLWTRDTSWALLYFLCYILPQTAPQVLRIGGIFETVENEPVNVEELAFKF
AVTSINRNRTLMPNTTLTYDIQRINLFDSFEASRRACDQLALGVAALFGPSHSSSVSAVQ
SICNALEVPHIQTRWKHPSVDNKDLFYINLYPDYAAISRAILDLVLYYNWKTVTVVYEDS
TGLIRLQELIKAPSRYNIKIKIRQLPSGNKDAKPLLKEMKKGKEFYVIFDCSHETAAEIL
KQILFMGMMTEYYHYFFTTLDLFALDLELYRYSGVNMTGFRLLNIDNPHVSSIIEKWSME
RLQAPPRPETGLLDGMMTTEAALMYDAVYMVAIASHRASQLTVSSLQCHRHKPWRLGPRF
MNLIKEARWDGLTGHITFNKTNGLRKDFDLDIISLKEEGTEKAAGEVSKHLYKVWKKIGI
WNSNSGLNMTDSNKDKSSNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCL
DLLKELSNILGFIYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREK
VIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFT
PYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTL
IIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKM
WAFMSSRQQTALVRNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYG
VGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEDNKEASALGVENIGGIFI
VLAAGLVLSVFVAIGEFIYKSRKNNDIEQAFCFFYGLQCKQTHPTNSTSGTTLSTDLECG
KLIREERGIRKQSSVHTV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50002370
NameBDBM50002370
Synonyms:(R,S)-alpha-amino-3-hydroxy-5-methyl-4-isooxazole-propionic acid | (RS)-2-amino-3-(3-hydroxy-5-methylisoxazol-4-yl)-propionicacid | 2-Amino-3-(3-hydroxy-5-methyl-isoxazol-4-yl)-propionic acid | 2-Amino-3-(3-hydroxy-5-methyl-isoxazol-4-yl)-propionic acid(DL-AMPA) | 2-amino-3-(3-hydroxy-5-methyl-4-isoxazolyl)-propionic acid | 2-amino-3-(5-methyl-3-oxo-2,3-dihydroisoxazol-4-yl)propanoic acid | 2-ammonio-3-(3-hydroxy-5-methylisoxazol-4-yl)propanoate | AMPA | CHEMBL13378
TypeSmall organic molecule
Emp. Form.C7H10N2O4
Mol. Mass.186.1653
SMILESCc1o[nH]c(=O)c1CC(N)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a