Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlutamate receptor ionotropic AMPA
LigandBDBM50017244
Substrate/Competitorn/a
Meas. Tech.ChEMBL_90305
Ki 11700±n/a nM
Citation Bjerrum, EJKristensen, ASPickering, DSGreenwood, JRNielsen, BLiljefors, TSchousboe, ABräuner-Osborne, HMadsen, U Design, synthesis, and pharmacology of a highly subtype-selective GluR1/2 agonist, (RS)-2-amino-3-(4-chloro-3-hydroxy-5-isoxazolyl)propionic acid (Cl-HIBO). J Med Chem46:2246-9 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glutamate receptor ionotropic AMPA
Name:Glutamate receptor AMPA 3/4
Synonyms:Glutamate receptor ionotropic, AMPA 4
Type:PROTEIN
Mol. Mass.:100881.87
Organism:Homo sapiens (Human)
Description:ChEMBL_468628
Residue:902
Sequence:
MRIISRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEA
PFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITP
SFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWH
VSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIA
NLGFKDISLERFIHGGANVTGFQLVDFNTPMVIKLMDRWKKLDQREYPGSETPPKYTSAL
TYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGN
VQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDVPTLGNDTAAIENRTVVVT
TIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTK
IWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL
DPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLW
FSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAED
LAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKG
KFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRTPVNLAVLKLSEAGV
LDKLKNKWWYDKGECGPKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKS
RAEAKRMKLTFSEAIRNKARLSITGSVGENGRVLTPDCPKAVHTGTAIRQSSGLAVIASD
LP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50017244
NameBDBM50017244
Synonyms:(R,S)-2-amino-3-(4-bromo-3-hydroxy-5-isoxazolyl)propionic acid | 2-Amino-3-(4-bromo-3-hydroxy-isoxazol-5-yl)-propionic acid | CHEMBL73698
TypeSmall organic molecule
Emp. Form.C6H7BrN2O4
Mol. Mass.251.035
SMILESNC(Cc1o[nH]c(=O)c1Br)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a