Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEcdysone receptor
LigandBDBM50128483
Substrate/Competitorn/a
Meas. Tech.ChEBML_65453
EC50 980.0±n/a nM
Citation Smith, HCCavanaugh, CKFriz, JLThompson, CSSaggers, JAMichelotti, ELGarcia, JTice, CM Synthesis and SAR of cis-1-benzoyl-1,2,3,4-tetrahydroquinoline ligands for control of gene expression in ecdysone responsive systems. Bioorg Med Chem Lett13:1943-6 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ecdysone receptor
Name:Ecdysone receptor
Synonyms:20-hydroxy-ecdysone receptor | 20E receptor | AaEcR | EcRH | Ecdysteroid receptor | Nuclear receptor subfamily 1 group H member 1
Type:PROTEIN
Mol. Mass.:83656.95
Organism:Aedes aegypti
Description:ChEMBL_65453
Residue:776
Sequence:
MYRLNIVSTNPSGSVQQQQQAQGQQVISSVVRPQQQQPPPQLALVQTGGSGGTTTTIIGL
TSLNALNATTITGLVAGAAGSSTSAIAAAGASNSGSGPSTATTKHILKAATTNNNISIVK
IVDDIMLKAVKVEPLPMDTGGGGGGVSMIPSSATTSGGVTVTAIPASVAPMPPVAAGTNV
SSNGSVTVYASGKRRLESNEEWISSPSPGSVPGSAPPLSPSPGSQSTTYTTTMSNGYSSP
MSTGSYDPYSPNGKMGREDLSPSSSLNGYTDGSDAKKQKKGPTPRQQEELCLVCGDRESG
YHYNALTCEGCKGFFRRSVTKNAVYCCKFGHACEMDMYMRRKCQECRLKKCLAVGMRPEC
VVPENQCAIKRKEKKAQKEKDKVQTNATVSTTNSTYRSEILPILMKCDPPPHQAIPLLPE
KLLQENRLRNIPLLTANQMAVIYKLIWYQDGYEQPSEEDLKRIMIGSPNEEEDQHDVHFR
HITEITILTVQLIVEFAKGLPAFTKIPQEDQITLLKACSSEVMMLRMARRYDAATDSILF
ANNRSYTRDSYRMAGMADTIEDLLHFCRQMFSLTVDNVEYALLTAIVIFSDRPGLEQAEL
VEHIQSYYIDTLRIYILNRHAGDPKCSVIFAKLLSILTELRTLGNQNSEMCFSLKLKNRK
LPRFLEEIWDVQDIPPSMQAQMHSHGTQSSSSSSSSSSSSSNGSSNGNSSSNSNSSQHGP
HPHPHGQQLTPNQQQHQQQHSQLQQVHANGSGSGGGSNNNSSSGGVVPGLGMLDQV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50128483
NameBDBM50128483
Synonyms:(4-Chloro-phenyl)-((2R,4S)-2-methyl-4-phenylamino-3,4-dihydro-2H-quinolin-1-yl)-methanone | CHEMBL300573
TypeSmall organic molecule
Emp. Form.C23H21ClN2O
Mol. Mass.376.879
SMILESC[C@@H]1C[C@H](Nc2ccccc2)c2ccccc2N1C(=O)c1ccc(Cl)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a