Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine Kinase (AK)
LigandBDBM50135891
Substrate/Competitorn/a
Meas. Tech.ChEMBL_31127
IC50 3±n/a nM
Citation Perner, RJGu, YGLee, CHBayburt, EKMcKie, JAlexander, KMKohlhaas, KLWismer, CTMikusa, JJarvis, MFKowaluk, EABhagwat, SS 5,6,7-trisubstituted 4-aminopyrido[2,3-d]pyrimidines as novel inhibitors of adenosine kinase. J Med Chem46:5249-57 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine Kinase (AK)
Name:Adenosine Kinase (AK)
Synonyms:ADENOSINE | Adenosine 5-phosphotransferase
Type:Enzyme
Mol. Mass.:40130.14
Organism:Rattus norvegicus (rat)
Description:Rat brain cytosol as enzyme source.
Residue:361
Sequence:
MAAADEPKPKKLKVEAPEALSENVLFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDK
HKELFDELVKKFKVEYHAGGSTQNSMKVAQWMIQEPHRAATFFGCIGIDKFGEILKSKAA
DAHVDAHYYEQNEQPTGTCAACITGGNRSLVANLAAANCYKKEKHLDLENNWMLVEKARV
YYIAGFFLTVSPESVLKVARYAAENNRTFTLNLSAPFISQFFKEALMEVMPYVDILFGNE
TEAATFAREQGFETKDIKEIARKTQALPKVNSKRQRTVIFTQGRDDTIVATGNDVTAFPV
LDQNQEEIVDTNGAGDAFVGGFLSQLVSNKPLTECIRAGHYAASVIIRRTGCTFPEKPDF
H
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50135891
n/a
NameBDBM50135891
Synonyms:CHEMBL346622 | [4-Amino-5-(3-bromo-phenyl)-7-thiophen-2-yl-pyrido[2,3-d]pyrimidin-6-yl]-acetic acid methyl ester
TypeSmall organic molecule
Emp. Form.C20H15BrN4O2S
Mol. Mass.455.328
SMILESCOC(=O)Cc1c(nc2ncnc(N)c2c1-c1cccc(Br)c1)-c1cccs1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: