Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKappa-type opioid receptor
LigandBDBM50138768
Substrate/Competitorn/a
Meas. Tech.ChEMBL_145815
Ki 0.2±n/a nM
Citation Vig, BSMurray, TFAldrich, JV Synthesis and opioid activity of side-chain-to-side-chain cyclic dynorphin A-(1-11) amide analogues cyclized between positions 2 and 5. 1. Substitutions in position 3. J Med Chem47:446-55 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Kappa-type opioid receptor
Name:Kappa-type opioid receptor
Synonyms:KOR-1 | Kappa Opioid Receptor | OPIATE Kappa
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:42692.90
Organism:Rattus norvegicus (rat)
Description:P34975
Residue:380
Sequence:
MESPIQIFRGEPGPTCAPSACLLPNSSSWFPNWAESDSNGSVGSEDQQLEPAHISPAIPV
IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSAVYL
MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI
CIWLLASSVGISAIVLGGTKVREDVDVIECSLQFPDDEYSWWDLFMKICVFVFAFVIPVL
IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITKLVLVVVAVFIICWTPIHIFILVEALG
STSHSTAVLSSYYFCIALGYTNSSLNPVLYAFLDENFKRCFRDFCFPIKMRMERQSTNRV
RNTVQDPASMRDVGGMNKPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50138768
NameBDBM50138768
Synonyms:CHEMBL438781 | Linear [D-Asp2,Dap5]Dyn A-(1-13)NH2
TypeSmall organic molecule
Emp. Form.C74H124N26O16
Mol. Mass.1633.941
SMILESCC[C@H](C)[C@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CN)NC(=O)[C@H](Cc1ccccc1)NC(=O)CNC(=O)[C@@H](CC(O)=O)NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a