Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M2
LigandBDBM50142815
Substrate/Competitorn/a
Meas. Tech.ChEBML_139762
Ki 27±n/a nM
Citation Palani, ADugar, SClader, JWGreenlee, WJRuperto, VDuffy, RALachowicz, JE Isopropyl amide derivatives of potent and selective muscarinic M2 receptor antagonists. Bioorg Med Chem Lett14:1791-4 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M2
Name:Muscarinic acetylcholine receptor M2 and M5
Synonyms:CHRM2 | Cholinergic, muscarinic M2 | RecName: Full=Muscarinic acetylcholine receptor M2
Type:GPCR
Mol. Mass.:51730.61
Organism:Homo sapiens (Human)
Description:P08172
Residue:466
Sequence:
MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKDKKEPVANQDPVSPSLVQGRI
VKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50142815
NameBDBM50142815
Synonyms:4-[1'-(1H-Benzoimidazole-4-carbonyl)-[1,4']bipiperidinyl-4-ylmethyl]-N-isopropyl-benzamide | CHEMBL53965
TypeSmall organic molecule
Emp. Form.C29H37N5O2
Mol. Mass.487.6364
SMILESCC(C)NC(=O)c1ccc(CC2CCN(CC2)C2CCN(CC2)C(=O)c2cccc3nc[nH]c23)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a