Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEpoxide hydratase
LigandBDBM50143934
Substrate/Competitorn/a
Meas. Tech.ChEMBL_67375
IC50 22000±n/a nM
Citation Kim, IHMorisseau, CWatanabe, THammock, BD Design, synthesis, and biological activity of 1,3-disubstituted ureas as potent inhibitors of the soluble epoxide hydrolase of increased water solubility. J Med Chem47:2110-22 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Epoxide hydratase
Name:Epoxide hydratase
Synonyms:Soluble epoxide hydrolase (sEH) | epoxide hydrolase 2, cytoplasmic
Type:Enzyme
Mol. Mass.:62613.07
Organism:Homo sapiens (Human)
Description:P34913
Residue:555
Sequence:
MTLRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITL
SQWIPLMEENCRKCSETAKVCLPKNFSIKEIFDKAISARKINRPMLQAALMLRKKGFTTA
ILTNTWLDDRAERDGLAQLMCELKMHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEV
VFLDDIGANLKPARDLGMVTILVQDTDTALKELEKVTGIQLLNTPAPLPTSCNPSDMSHG
YVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESS
APPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNT
PFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMH
KVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSL
GRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIK
WLDSDARNPPVVSKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50143934
NameBDBM50143934
Synonyms:CHEMBL69495 | Carbonic acid 2-[3-(3-chloro-phenyl)-ureido]-ethyl ester pentyl ester
TypeSmall organic molecule
Emp. Form.C15H21ClN2O4
Mol. Mass.328.791
SMILESCCCCCOC(=O)OCCNC(=O)Nc1cccc(Cl)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a