Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPoly [ADP-ribose] polymerase 1
LigandBDBM50145216
Substrate/Competitorn/a
Meas. Tech.ChEBML_159827
Ki 4.5±n/a nM
Citation White, AWCurtin, NJEastman, BWGolding, BTHostomsky, ZKyle, SLi, JMaegley, KASkalitzky, DJWebber, SEYu, XHGriffin, RJ Potentiation of cytotoxic drug activity in human tumour cell lines, by amine-substituted 2-arylbenzimidazole-4-carboxamide PARP-1 inhibitors. Bioorg Med Chem Lett14:2433-7 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Poly [ADP-ribose] polymerase 1
Name:Poly [ADP-ribose] polymerase 1
Synonyms:(ARTD1 or PARP1) | ADP-ribosyltransferase diphtheria toxin-like 1 | ADPRT | ADPRT 1 | ARTD1 | DNA ADP-ribosyltransferase PARP1 | Human diphtheria toxin-like ADP-ribosyltransferase (ARTD1 or PARP1) | NAD(+) ADP-ribosyltransferase 1 | PARP-1 | PARP1 | PPOL | Poly [ADP-ribose] polymerase (PARP) | Poly [ADP-ribose] polymerase 1 (PARP) | Poly [ADP-ribose] polymerase 1 (PARP-1) | Poly [ADP-ribose] polymerase 1 (PARP1) | Poly [ADP-ribose] polymerase-1 | Poly(ADP-ribose) polymerase 1 (PARP1) | Poly(ADP-ribose) polymerase-1 (ARTD1/PARP1) | Poly[ADP-ribose] synthase 1 | Protein poly-ADP-ribosyltransferase PARP1
Type:n/a
Mol. Mass.:113114.22
Organism:Homo sapiens (Human)
Description:P09874
Residue:1014
Sequence:
MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKV
GHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKS
NRSTCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQ
LKGFSLLATEDKEALKKQLPGVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKA
QNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSG
QLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPPE
TSASVAATPPPSTASAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLT
GTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSP
WGAEVKAEPVEVVAPRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLE
HSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNK
LEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPG
TKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQAV
SQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRG
GSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIE
REGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM
VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA
NISLDGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50145216
NameBDBM50145216
Synonyms:2-(4-{[Bis-(2-hydroxy-ethyl)-amino]-methyl}-phenyl)-1H-benzoimidazole-4-carboxylic acid amide | CHEMBL79218
TypeSmall organic molecule
Emp. Form.C19H22N4O3
Mol. Mass.354.403
SMILESNC(=O)c1cccc2[nH]c(nc12)-c1ccc(CN(CCO)CCO)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a