Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphodiesterase 2A
LigandBDBM14361
Substrate/Competitorn/a
Meas. Tech.ChEBML_156330
IC50>10000±n/a nM
Citation Pitts, WJVaccaro, WHuynh, TLeftheris, KRoberge, JYBarbosa, JGuo, JBrown, BWatson, ADonaldson, KStarling, GCKiener, PAPoss, MADodd, JHBarrish, JC Identification of purine inhibitors of phosphodiesterase 7 (PDE7). Bioorg Med Chem Lett14:2955-8 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Phosphodiesterase 2A
Name:Phosphodiesterase 2A
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:104640.72
Organism:Rattus norvegicus
Description:ChEMBL_156330
Residue:928
Sequence:
MVLVLHHILIAVVQFLRRGQQVFLKPDEPPPQPCADSLQDALLSLGAVIDIAGLRQAAKD
ALSAVLPKVETVYTYLVDGESRLVCEDPPHELPQEGKIREAVISRKRLSCDGLGPSDLLG
KPLARLVAPLAPDTQVLVIPLLDKETGTVAAVILVHCGQLSDSEEQSLQVVEKHALVALQ
RVQALQQRRPEAVQNTSADPSEDQKDEKGYTAHDRKILQLCGELYDLDATSLQLKVLRYL
QQETQATHCCLLLVSEDNLQLSCKVIGEKVLGEEVSFPLTMGRLGQVVEDKQCIQLKDLT
SDDVQQLQNMLGCELRAMLCVPVISRATDQVVALACAFNKLGGDFFTDEDERAIQHCFHY
TGTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSV
FLLDQNELVAKVFDGGVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRGVD
DSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSL
LYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFANFTYTPRSLPE
DDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLY
KNLELSNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFA
QAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRNN
KQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREK
AYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNNS
LDFLDEEYEVPDLDVTRAPVNGCCSLEG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM14361
NameBDBM14361
Synonyms:(R,S)-Rolipram | 4-(3-cyclopentyloxy-4-methoxy-phenyl)pyrrolidin-2-one | 4-[3-(cyclopentyloxy)-4-methoxyphenyl]pyrrolidin-2-one | Adeo | CHEMBL63 | Rolipram
TypeSmall organic molecule
Emp. Form.C16H21NO3
Mol. Mass.275.3428
SMILESCOc1ccc(cc1OC1CCCC1)C1CNC(=O)C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a