Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetphosphatase Cdc25
LigandBDBM50147583
Substrate/Competitorn/a
Meas. Tech.ChEMBL_49004
IC50 890±n/a nM
Citation Shimazawa, RSuzuki, TDodo, KShirai, R Design and synthesis of dysidiolide analogs from vitamin D3: novel class of Cdc25A inhibitors. Bioorg Med Chem Lett14:3291-4 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
phosphatase Cdc25
Name:Dual specificity phosphatase Cdc25A
Synonyms:Dual specificity phosphatase (Cdc25A) | Dual specificity phosphatase Cdc25A | M-phase inducer phosphatase 1
Type:Protein
Mol. Mass.:59090.18
Organism:Homo sapiens (Human)
Description:P30304
Residue:524
Sequence:
MELGPEPPHRRRLLFACSPPPASQPVVKALFGASAAGGLSPVTNLTVTMDQLQGLGSDYE
QPLEVKNNSNLQRMGSSESTDSGFCLDSPGPLDSKENLENPMRRIHSLPQKLLGCSPALK
RSHSDSLDHDIFQLIDPDENKENEAFEFKKPVRPVSRGCLHSHGLQEGKDLFTQRQNSAP
ARMLSSNERDSSEPGNFIPLFTPQSPVTATLSDEDDGFVDLLDGENLKNEEETPSCMASL
WTAPLVMRTTNLDNRCKLFDSPSLCSSSTRSVLKRPERSQEESPPGSTKRRKSMSGASPK
ESTNPEKAHETLHQSLSLASSPKGTIENILDNDPRDLIGDFSKGYLFHTVAGKHQDLKYI
SPEIMASVLNGKFANLIKEFVIIDCRYPYEYEGGHIKGAVNLHMEEEVEDFLLKKPIVPT
DGKRVIVVFHCEFSSERGPRMCRYVRERDRLGNEYPKLHYPELYVLKGGYKEFFMKCQSY
CEPPSYRPMHHEDFKEDLKKFRTKSRTWAGEKSKREMYSRLKKL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50147583
NameBDBM50147583
Synonyms:(S)-4-Methylene-3-{2-[(R)-7a-(R)-methyl-1-((R)-5-methyl-1-methyl-hexyl)-octahydro-inden-(4E)-ylidene]-ethylidene}-cyclohexanol | CHEMBL432780
TypeSmall organic molecule
Emp. Form.C27H44O
Mol. Mass.384.6377
SMILESCC(C)CCC[C@@H](C)[C@H]1CCC2\C(CCC[C@]12C)=C\C=C1\C[C@@H](O)CCC1=C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a