Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHomeobox protein Brn-2
LigandBDBM50149552
Substrate/Competitorn/a
Meas. Tech.ChEMBL_305969
IC50>10000000±n/a nM
Citation Ji, TLee, MPruitt, SCHangauer, DG Privileged scaffolds for blocking protein-protein interactions: 1,4-disubstituted naphthalene antagonists of transcription factor complex HOX-PBX/DNA. Bioorg Med Chem Lett14:3875-9 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Homeobox protein Brn-2
Name:Homeobox protein Brn-2
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:46908.80
Organism:Homo sapiens (Human)
Description:ChEMBL_305969
Residue:443
Sequence:
MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHPLSHAHQ
WITALSHGGGGGGGGGGGGGGGGGGGGGDGSPWSTSPLGQPDIKPSVVVQQGGRGDELHG
PGALQQQHQQQQQQQQQQQQQQQQQQQQQRPPHLVHHAANHHPGPGAWRSAAAAAHLPPS
MGASNGGLLYSQPSFTVNGMLGAGGQPAGLHHHGLRDAHDEPHHADHHPHPHSHPHQQPP
PPPPPQGPPGHPGAHHDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYG
NVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGRKRKKRTS
IEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGTLP
GAEDVYGGSRDTPPHHGVQTPVQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50149552
NameBDBM50149552
Synonyms:4-Cyclopropylcarbamoylmethoxy-naphthalene-1-carboxylic acid (3-fluoro-phenyl)-amide | CHEMBL182776
TypeSmall organic molecule
Emp. Form.C22H19FN2O3
Mol. Mass.378.3963
SMILESFc1cccc(NC(=O)c2ccc(OCC(=O)NC3CC3)c3ccccc23)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a