Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclooxygenase-1 (COX-1)
LigandBDBM50151759
Substrate/Competitorn/a
Meas. Tech.ChEMBL_306058
IC50 6000±n/a nM
Citation Campbell, JABordunov, VBroka, CABrowner, MFKress, JMMirzadegan, TRamesha, CSanpablo, BFStabler, RTakahara, PVillasenor, AWalker, KAWang, JHWelch, MWeller, P Rational design of 6-methylsulfonylindoles as selective cyclooxygenase-2 inhibitors. Bioorg Med Chem Lett14:4741-5 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cyclooxygenase-1 (COX-1)
Name:Cyclooxygenase
Synonyms:COX-1 | Cyclooxygenase-1 | Prostaglandin G/H synthase (cyclooxygenase)
Type:Enzyme
Mol. Mass.:68692.62
Organism:Homo sapiens (Human)
Description:P23219
Residue:599
Sequence:
MSRSLLLWFLLFLLLLPPLPVLLADPGAPTPVNPCCYYPCQHQGICVRFGLDRYQCDCTR
TGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRS
NLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRF
LLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQ
YQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLY
ATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLKF
DPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEA
LVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQEL
VGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICS
PEYWKPSTFGGEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50151759
NameBDBM50151759
Synonyms:6-Methanesulfonyl-3-(4-methoxy-phenoxy)-2-methyl-1H-indole | CHEMBL433756
TypeSmall organic molecule
Emp. Form.C17H17NO4S
Mol. Mass.331.386
SMILESCOc1ccc(Oc2c(C)[nH]c3cc(ccc23)S(C)(=O)=O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a