Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFatty acid binding protein muscle
LigandBDBM50152891
Substrate/Competitorn/a
Meas. Tech.ChEMBL_306241
IC50>100000±n/a nM
Citation Ringom, RAxen, EUppenberg, JLundbäck, TRondahl, LBarf, T Substituted benzylamino-6-(trifluoromethyl)pyrimidin-4(1H)-ones: a novel class of selective human A-FABP inhibitors. Bioorg Med Chem Lett14:4449-52 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Fatty acid binding protein muscle
Name:Fatty acid binding protein muscle
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:14858.36
Organism:Homo sapiens (Human)
Description:ChEMBL_1463784
Residue:133
Sequence:
MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKN
TEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTH
GTAVCTRTYEKEA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50152891
NameBDBM50152891
Synonyms:2-(4-Chloro-benzylamino)-6-trifluoromethyl-pyrimidin-4-ol | CHEMBL184852
TypeSmall organic molecule
Emp. Form.C12H9ClF3N3O
Mol. Mass.303.668
SMILESFC(F)(F)c1cc(=O)[nH]c(NCc2ccc(Cl)cc2)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a