Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNck adaptor protein 1
LigandBDBM50154582
Substrate/Competitorn/a
Meas. Tech.ChEMBL_304472
EC50>500000±n/a nM
Citation Inglis, SRStojkoski, CBranson, KMCawthray, JFFritz, DWiadrowski, EPyke, SMBooker, GW Identification and specificity studies of small-molecule ligands for SH3 protein domains. J Med Chem47:5405-17 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Nck adaptor protein 1
Name:Nck adaptor protein 1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:42863.46
Organism:Homo sapiens
Description:ChEMBL_304472
Residue:377
Sequence:
MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKN
SARKASIVKNLKDTLGIGKVKRKPSVPDSASPADDSFVDPGERLYDLNMPAYVKFNYMAE
REDELSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYVTEEGDSPLGDHVGSLSEKLA
AVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVG
LVPKNYVTVMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERG
HEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHYKKAP
IFTSEQGEKLYLVKHLS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50154582
NameBDBM50154582
Synonyms:6-[1,3]Dioxan-2-yl-quinolin-2-ylamine | CHEMBL426622
TypeSmall organic molecule
Emp. Form.C13H14N2O2
Mol. Mass.230.2625
SMILESNc1ccc2cc(ccc2n1)C1OCCCO1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a