Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNitric oxide synthase, endothelial
LigandBDBM50104653
Substrate/Competitorn/a
Meas. Tech.ChEMBL_305309
IC50 13400±n/a nM
Citation Shankaran, KDonnelly, KLShah, SKCaldwell, CGChen, PHagmann, WKMaccoss, MHumes, JLPacholok, SGKelly, TMGrant, SKWong, KK Synthesis of analogs of (1,4)-3- and 5-imino oxazepane, thiazepane, and diazepane as inhibitors of nitric oxide synthases. Bioorg Med Chem Lett14:5907-11 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Nitric oxide synthase, endothelial
Name:Nitric oxide synthase, endothelial
Synonyms:Constitutive NOS | Endothelial NOS | Endothelial nitric oxide synthase | NOS type III | Nitric oxide synthase (inducible and endothelial) | Nitric oxide synthase, endothelial (eNOS) | Nitric-oxide synthase (endothelial and brain) | cNOS | eNOS
Type:Enzyme Catalytic Domain
Mol. Mass.:133297.84
Organism:Homo sapiens (Human)
Description:P29474
Residue:1203
Sequence:
MGNLKSVAQEPGPPCGLGLGLGLGLCGKQGPATPAPEPSRAPASLLPPAPEHSPPSSPLT
QPPEGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSPGPPAP
EQLLSQARDFINQYYSSIKRSGSQAHEQRLQEVEAEVAATGTYQLRESELVFGAKQAWRN
APRCVGRIQWGKLQVFDARDCRSAQEMFTYICNHIKYATNRGNLRSAITVFPQRCPGRGD
FRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDEPP
ELFLLPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYMST
EIGTRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINVAVLHSYQLAKVTIVDH
HAATASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYFLSPAFRYQPDPW
KGSAAKGTGITRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQSYAQQLGR
LFRKAFDPRVLCMDEYDVVSLEHETLVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSS
PRPEQHKSYKIRFNSISCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHF
CAFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQAACETFCVGEDAKAAA
RDIFSPKRSWKRQRYRLSAQAEGLQLLPGLIHVHRRKMFQATIRSVENLQSSKSTRATIL
VRLDTGGQEGLQYQPGDHIGVCPPNRPGLVEALLSRVEDPPAPTEPVAVEQLEKGSPGGP
PPGWVRDPRLPPCTLRQALTFFLDITSPPSPQLLRLLSTLAEEPREQQELEALSQDPRRY
EEWKWFRCPTLLEVLEQFPSVALPAPLLLTQLPLLQPRYYSVSSAPSTHPGEIHLTVAVL
AYRTQDGLGPLHYGVCSTWLSQLKPGDPVPCFIRGAPSFRLPPDPSLPCILVGPGTGIAP
FRGFWQERLHDIESKGLQPTPMTLVFGCRCSQLDHLYRDEVQNAQQRGVFGRVLTAFSRE
PDNPKTYVQDILRTELAAEVHRVLCLERGHMFVCGDVTMATNVLQTVQRILATEGDMELD
EAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERQLRGAVPWAFDPPGSDT
NSP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50104653
NameBDBM50104653
Synonyms:CHEMBL88308 | [1,4]Thiazepan-(5E)-ylideneamine | [1,4]Thiazepan-(5Z)-ylideneamine
TypeSmall organic molecule
Emp. Form.C5H10N2S
Mol. Mass.130.211
SMILESNC1=NCCSCC1 |t:1|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a