Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin S
LigandBDBM50156084
Substrate/Competitorn/a
Meas. Tech.ChEMBL_306474
IC50 50±n/a nM
Citation Altmann, ECowan-Jacob, SWMissbach, M Novel purine nitrile derived inhibitors of the cysteine protease cathepsin K. J Med Chem47:5833-6 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cathepsin S
Name:Cathepsin S
Synonyms:CTSS | Cathepsin S (Cat S) | cathepsin S preproprotein
Type:Protein
Mol. Mass.:37507.38
Organism:Homo sapiens (Human)
Description:P25774
Residue:331
Sequence:
MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVM
LHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVD
WREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGC
NGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKE
AVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSW
GHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50156084
NameBDBM50156084
Synonyms:9-Cyclopentyl-6-(2-{4-[2-(4-methyl-piperazin-1-yl)-ethoxy]-benzyloxy}-phenylamino)-9H-purine-2-carbonitrile | CHEMBL189730
TypeSmall organic molecule
Emp. Form.C31H36N8O2
Mol. Mass.552.6699
SMILESCN1CCN(CCOc2ccc(COc3ccccc3Nc3nc(nc4n(cnc34)C3CCCC3)C#N)cc2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a