Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIntercellular adhesion molecule-1 /Leukocyte adhesion glycoprotein LFA-1 alpha
LigandBDBM50157365
Substrate/Competitorn/a
Meas. Tech.ChEMBL_305391
IC50 90±n/a nM
Citation Wang, GTWang, SGentles, RSowin, TLeitza, SReilly, EBvon Geldern, TW Amino-substituted heterocycles as isosteres of trans-cinnamides: design and synthesis of heterocyclic biaryl sulfides as potent antagonists of LFA-1/ICAM-1 binding. Bioorg Med Chem Lett15:195-201 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Intercellular adhesion molecule-1 /Leukocyte adhesion glycoprotein LFA-1 alpha
Name:Intercellular adhesion molecule-1 /Leukocyte adhesion glycoprotein LFA-1 alpha
Synonyms:n/a
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of EBI is 90530
Components:This complex has 2 components.
Component 1
Name:Integrin alpha-L/beta-2 (LFA-1)
Synonyms:CD11 antigen-like family member A | CD_antigen=CD11a | LFA-1A | Leukocyte adhesion glycoprotein LFA-1 alpha | Leukocyte adhesion glycoprotein LFA-1 alpha chain | Leukocyte function-associated molecule 1 alpha chain
Type:PROTEIN
Mol. Mass.:128748.90
Organism:Homo sapiens (Human)
Description:ChEMBL_629045
Residue:1170
Sequence:
MKDSCITVMAMALLSGFFFFAPASSYNLDVRGARSFSPPRAGRHFGYRVLQVGNGVIVGA
PGEGNSTGSLYQCQSGTGHCLPVTLRGSNYTSKYLGMTLATDPTDGSILACDPGLSRTCD
QNTYLSGLCYLFRQNLQGPMLQGRPGFQECIKGNVDLVFLFDGSMSLQPDEFQKILDFMK
DVMKKLSNTSYQFAAVQFSTSYKTEFDFSDYVKRKDPDALLKHVKHMLLLTNTFGAINYV
ATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDIIRYIIGIGKHFQTKESQETLH
KFASKPASEFVKILDTFEKLKDLFTELQKKIYVIEGTSKQDLTSFNMELSSSGISADLSR
GHAVVGAVGAKDWAGGFLDLKADLQDDTFIGNEPLTPEVRAGYLGYTVTWLPSRQKTSLL
ASGAPRYQHMGRVLLFQEPQGGGHWSQVQTIHGTQIGSYFGGELCGVDVDQDGETELLLI
GAPLFYGEQRGGRVFIYQRRQLGFEEVSELQGDPGYPLGRFGEAITALTDINGDGLVDVA
VGAPLEEQGAVYIFNGRHGGLSPQPSQRIEGTQVLSGIQWFGRSIHGVKDLEGDGLADVA
VGAESQMIVLSSRPVVDMVTLMSFSPAEIPVHEVECSYSTSNKMKEGVNITICFQIKSLI
PQFQGRLVANLTYTLQLDGHRTRRRGLFPGGRHELRRNIAVTTSMSCTDFSFHFPVCVQD
LISPINVSLNFSLWEEEGTPRDQRAQGKDIPPILRPSLHSETWEIPFEKNCGEDKKCEAN
LRVSFSPARSRALRLTAFASLSVELSLSNLEEDAYWVQLDLHFPPGLSFRKVEMLKPHSQ
IPVSCEELPEESRLLSRALSCNVSSPIFKAGHSVALQMMFNTLVNSSWGDSVELHANVTC
NNEDSDLLEDNSATTIIPILYPINILIQDQEDSTLYVSFTPKGPKIHQVKHMYQVRIQPS
IHDHNIPTLEAVVGVPQPPSEGPITHQWSVQMEPPVPCHYEDLERLPDAAEPCLPGALFR
CPVVFRQEILVQVIGTLELVGEIEASSMFSLCSSLSISFNSSKHFHLYGSNASLAQVVMK
VDVVYEKQMLYLYVLSGIGGLLLLLLIFIVLYKVGFFKRNLKEKMEAGRGVPNGIPAEDS
EQLASGQEAGDPGCLKPLHEKDSESGGGKD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Intercellular adhesion molecule (ICAM-1), Integrin alpha-L/beta-2
Synonyms:CD_antigen=CD54 | ICAM-1 | Intercellular adhesion molecule 1 | Intercellular adhesion molecule-1 | Major group rhinovirus receptor
Type:PROTEIN
Mol. Mass.:57831.10
Organism:Homo sapiens (Human)
Description:ChEMBL_826675
Residue:532
Sequence:
MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGI
ETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAP
LPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHH
GANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLD
GLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQE
TLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKA
TPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQ
AWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE
IVIITVVAAAVIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50157365
NameBDBM50157365
Synonyms:(2S,4R)-4-Hydroxy-1-{4-[4-(2-isopropyl-phenylsulfanyl)-3-trifluoromethyl-phenyl]-pyridin-2-yl}-pyrrolidine-2-carboxylic acid | CHEMBL183017
TypeSmall organic molecule
Emp. Form.C26H25F3N2O3S
Mol. Mass.502.549
SMILESCC(C)c1ccccc1Sc1ccc(cc1C(F)(F)F)-c1ccnc(c1)N1C[C@H](O)C[C@H]1C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a