Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTelomerase reverse transcriptase
LigandBDBM50157556
Substrate/Competitorn/a
Meas. Tech.ChEMBL_430015
IC50 6000±n/a nM
Citation Menichincheri, MBallinari, DBargiotti, ABonomini, LCeccarelli, WD'Alessio, RFretta, AMoll, JPolucci, PSoncini, CTibolla, MTrosset, JYVanotti, E Catecholic flavonoids acting as telomerase inhibitors. J Med Chem47:6466-75 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Telomerase reverse transcriptase
Name:Telomerase reverse transcriptase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:127099.03
Organism:Homo sapiens (Human)
Description:ChEMBL_1447029
Residue:1132
Sequence:
MPRAPRCRAVRSLLRSHYREVLPLATFVRRLGPQGWRLVQRGDPAAFRALVAQCLVCVPW
DARPPPAAPSFRQVSCLKELVARVLQRLCERGAKNVLAFGFALLDGARGGPPEAFTTSVR
SYLPNTVTDALRGSGAWGLLLRRVGDDVLVHLLARCALFVLVAPSCAYQVCGPPLYQLGA
ATQARPPPHASGPRRRLGCERAWNHSVREAGVPLGLPAPGARRRGGSASRSLPLPKRPRR
GAAPEPERTPVGQGSWAHPGRTRGPSDRGFCVVSPARPAEEATSLEGALSGTRHSHPSVG
RQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSLRPSLTGARRL
VETIFLGSRPWMPGTPRRLPRLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVT
PAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGS
RHNERRFLRNTKKFISLGKHAKLSLQELTWKMSVRDCAWLRRSPGVGCVPAAEHRLREEI
LAKFLHWLMSVYVVELLRSFFYVTETTFQKNRLFFYRKSVWSKLQSIGIRQHLKRVQLRE
LSEAEVRQHREARPALLTSRLRFIPKPDGLRPIVNMDYVVGARTFRREKRAERLTSRVKA
LFSVLNYERARRPGLLGASVLGLDDIHRAWRTFVLRVRAQDPPPELYFVKVDVTGAYDTI
PQDRLTEVIASIIKPQNTYCVRRYAVVQKAAHGHVRKAFKSHVSTLTDLQPYMRQFVAHL
QETSPLRDAVVIEQSSSLNEASSGLFDVFLRFMCHHAVRIRGKSYVQCQGIPQGSILSTL
LCSLCYGDMENKLFAGIRRDGLLLRLVDDFLLVTPHLTHAKTFLRTLVRGVPEYGCVVNL
RKTVVNFPVEDEALGGTAFVQMPAHGLFPWCGLLLDTRTLEVQSDYSSYARTSIRASLTF
NRGFKAGRNMRRKLFGVLRLKCHSLFLDLQVNSLQTVCTNIYKILLLQAYRFHACVLQLP
FHQQVWKNPTFFLRVISDTASLCYSILKAKNAGMSLGAKGAAGPLPSEAVQWLCHQAFLL
KLTRHRVTYVPLLGSLRTAQTQLSRKLPGTTLTALEAAANPALPSDFKTILD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50157556
NameBDBM50157556
Synonyms:3-(3,4-dihydroxyphenyl)-1-(2,3,4-trihydroxyphenyl)prop-2-en-1-one | CHEMBL222557
TypeSmall organic molecule
Emp. Form.C15H12O6
Mol. Mass.288.2522
SMILESOc1ccc(\C=C\C(=O)c2ccc(O)c(O)c2O)cc1O
Structure
n/a