Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCaspase-7
LigandBDBM50160987
Substrate/Competitorn/a
Meas. Tech.ChEMBL_305652
IC50 0.036000±n/a nM
Citation Han, YGiroux, AColucci, JBayly, CIMckay, DJRoy, SXanthoudakis, SVaillancourt, JRasper, DMTam, JTawa, PNicholson, DWZamboni, RJ Novel pyrazinone mono-amides as potent and reversible caspase-3 inhibitors. Bioorg Med Chem Lett15:1173-80 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Caspase-7
Name:Caspase
Synonyms:Apoptotic protease Mch-3 | CASP-7 | CMH-1 | caspase 7, apoptosis-related cysteine peptidase
Type:Enzyme
Mol. Mass.:34273.91
Organism:Homo sapiens (human)
Description:P55210
Residue:303
Sequence:
MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQY
NMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQ
DLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKL
FFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSW
FVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELY
FSQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50160987
NameBDBM50160987
Synonyms:(S)-3-(2-{5-tert-Butyl-3-[(4-methyl-furazan-3-ylmethyl)-amino]-2-oxo-2H-pyrazin-1-yl}-butyrylamino)-5-{[(methyl-pentyl-amino)-methyl]-amino}-4-oxo-pentanoic acid | CHEMBL180669
TypeSmall organic molecule
Emp. Form.C28H46N8O6
Mol. Mass.590.7148
SMILESCCCCCN(C)CNCC(=O)[C@H](CC(O)=O)NC(=O)C(CC)n1cc(nc(NCc2nonc2C)c1=O)C(C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a