Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPAK1
LigandBDBM31090
Substrate/Competitorn/a
Meas. Tech.ChEMBL_325114
Kd 2100±n/a nM
Citation Fabian, MABiggs, WHTreiber, DKAtteridge, CEAzimioara, MDBenedetti, MGCarter, TACiceri, PEdeen, PTFloyd, MFord, JMGalvin, MGerlach, JLGrotzfeld, RMHerrgard, SInsko, DEInsko, MALai, AGLélias, JMMehta, SAMilanov, ZVVelasco, AMWodicka, LMPatel, HKZarrinkar, PPLockhart, DJ A small molecule-kinase interaction map for clinical kinase inhibitors. Nat Biotechnol23:329-36 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
PAK1
Name:PAK1
Synonyms:2.7.11.1 | Alpha-PAK | PAK-1 | Serine/threonine-protein kinase PAK 1 | p21-activated kinase 1 | p65-PAK
Type:n/a
Mol. Mass.:60640.15
Organism:Homo sapiens (Human)
Description:Q13153
Residue:545
Sequence:
MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILP
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDD
DDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTE
KQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQ
MNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETC
MDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSK
RSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNG
TPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEA
TKNNH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31090
n/a
NameBDBM31090
Synonyms:(E)-N-[4-(3-chloro-4-fluoro-anilino)-3-cyano-7-ethoxy-6-quinolyl]-4-(dimethylamino)but-2-enamide | (E)-N-[4-(3-chloro-4-fluoroanilino)-3-cyano-7-ethoxy-6-quinolinyl]-4-(dimethylamino)-2-butenamide | (E)-N-[4-(3-chloro-4-fluoroanilino)-3-cyano-7-ethoxyquinolin-6-yl]-4-(dimethylamino)but-2-enamide | (E)-N-[4-[(3-chloranyl-4-fluoranyl-phenyl)amino]-3-cyano-7-ethoxy-quinolin-6-yl]-4-(dimethylamino)but-2-enamide | EKB-569 | Pelitinib | cid_6445562
TypeSmall organic molecule
Emp. Form.C24H23ClFN5O2
Mol. Mass.467.923
SMILESCCOc1cc2ncc(C#N)c(Nc3ccc(F)c(Cl)c3)c2cc1NC(=O)\C=C\CN(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: