Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase MST2
LigandBDBM31090
Substrate/Competitorn/a
Meas. Tech.ChEMBL_325015
Kd 1100±n/a nM
Citation Fabian, MABiggs, WHTreiber, DKAtteridge, CEAzimioara, MDBenedetti, MGCarter, TACiceri, PEdeen, PTFloyd, MFord, JMGalvin, MGerlach, JLGrotzfeld, RMHerrgard, SInsko, DEInsko, MALai, AGLélias, JMMehta, SAMilanov, ZVVelasco, AMWodicka, LMPatel, HKZarrinkar, PPLockhart, DJ A small molecule-kinase interaction map for clinical kinase inhibitors. Nat Biotechnol23:329-36 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase MST2
Name:Serine/threonine-protein kinase MST2
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:56831.05
Organism:Mus musculus
Description:ChEMBL_325015
Residue:497
Sequence:
MEQPPASKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPV
ESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTE
DEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNT
VIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPT
FRKPELWSDDFTDFVKKCLVKSPEQRATATQLLQHPFIKNAKPVSILRDLIAEAMEIKAK
RHEEQQRELEEEEENSDEDELDSHTMVKTSSESVGTMRATSTMSEGAQTMIEHNSTMLES
DLGTMVINSEEEEEEEEEEEEDGTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCDQSM
REPGPMSNSVFPDNWRVPQDGDFDFLKNLSLEELQMRLKALDPMMEREIEELHQRYSAKR
QPILDAMDAKKRRQQNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31090
NameBDBM31090
Synonyms:(E)-N-[4-(3-chloro-4-fluoro-anilino)-3-cyano-7-ethoxy-6-quinolyl]-4-(dimethylamino)but-2-enamide | (E)-N-[4-(3-chloro-4-fluoroanilino)-3-cyano-7-ethoxy-6-quinolinyl]-4-(dimethylamino)-2-butenamide | (E)-N-[4-(3-chloro-4-fluoroanilino)-3-cyano-7-ethoxyquinolin-6-yl]-4-(dimethylamino)but-2-enamide | (E)-N-[4-[(3-chloranyl-4-fluoranyl-phenyl)amino]-3-cyano-7-ethoxy-quinolin-6-yl]-4-(dimethylamino)but-2-enamide | EKB-569 | Pelitinib | cid_6445562
TypeSmall organic molecule
Emp. Form.C24H23ClFN5O2
Mol. Mass.467.923
SMILESCCOc1cc2ncc(C#N)c(Nc3ccc(F)c(Cl)c3)c2cc1NC(=O)\C=C\CN(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a