Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNitric oxide synthase, inducible
LigandBDBM50161390
Substrate/Competitorn/a
Meas. Tech.ChEMBL_304747
IC50 80±n/a nM
Citation Ueda, STerauchi, HSuzuki, KYano, AMatsumoto, MKubo, TMinato, HArai, YTsuji, JWatanabe, N Novel and orally bioavailable inducible nitric oxide synthase inhibitors: synthesis and evaluation of optically active 4,5-dialkyl-2-iminoselenazolidine derivatives. Bioorg Med Chem Lett15:1361-6 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Nitric oxide synthase, inducible
Name:Nitric oxide synthase, inducible
Synonyms:HEP-NOS | Hepatocyte NOS | Inducible NO synthase | Inducible NOS | NOS type II | Nitric oxide synthase, inducible (iNOS) | iNOS
Type:Homodimer
Mol. Mass.:131141.95
Organism:Homo sapiens (Human)
Description:P35228
Residue:1153
Sequence:
MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPL
VETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIM
TPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQ
LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAREMFEHICRHVRYSTNNGNI
RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWKPKYG
RFDVVPLVLQANGRDPELFEIPPDLVLEVAMEHPKYEWFRELELKWYALPAVANMLLEVG
GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDQAVVEINI
AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPMSGSITPVFHQEM
LNYVLSPFYYYQVEAWKTHVWQDEKRRPKRREIPLKVLVKAVLFACMLMRKTMASRVRVT
ILFATETGKSEALAWDLGALFSCAFNPKVVCMDKYRLSCLEEERLLLVVTSTFGNGDCPG
NGEKLKKSLFMLKELNNKFRYAVFGLGSSMYPRFCAFAHDIDQKLSHLGASQLTPMGEGD
ELSGQEDAFRSWAVQTFKAACETFDVRGKQHIQIPKLYTSNVTWDPHHYRLVQDSQPLDL
SKALSSMHAKNVFTMRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPGEHLGVCPGNQ
PALVQGILERVVDGPTPHQTVRLEALDESGSYWVSDKRLPPCSLSQALTYFLDITTPPTQ
LLLQKLAQVATEEPERQRLEALCQPSEYSKWKFTNSPTFLEVLEEFPSLRVSAGFLLSQL
PILKPRFYSISSSRDHTPTEIHLTVAVVTYHTRDGQGPLHHGVCSTWLNSLKPQDPVPCF
VRNASGFHLPEDPSHPCILIGPGTGIAPFRSFWQQRLHDSQHKGVRGGRMTLVFGCRRPD
EDHIYQEEMLEMAQKGVLHAVHTAYSRLPGKPKVYVQDILRQQLASEVLRVLHKEPGHLY
VCGDVRMARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQKRYHEDIFGAVFPYEAKKDR
VAVQPSSLEMSAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50161390
NameBDBM50161390
Synonyms:(4S,5R)-4-Ethyl-5-methyl-selenazolidin-(2Z)-ylideneamine | CHEMBL178389
TypeSmall organic molecule
Emp. Form.C6H12N2Se
Mol. Mass.191.13
SMILESCC[C@@H]1N=C(N)[Se][C@@H]1C |t:3|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a